Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_073038817.1 BUB04_RS09760 enoyl-CoA hydratase/isomerase family protein
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_900129305.1:WP_073038817.1 Length = 259 Score = 135 bits (341), Expect = 7e-37 Identities = 90/244 (36%), Positives = 126/244 (51%), Gaps = 2/244 (0%) Query: 19 LTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADNFFCAGGNLNRLLENRAK 78 + ++ P NAL+ + +AL + D S+R V++TG FCAGG+L L+ A Sbjct: 16 VAMNRPKNLNALNLQLMTELADALTAAAADASVRGVLLTGRGKAFCAGGDLKWALDF-AD 74 Query: 79 DPSVQAQSIDLLAEWISA-LRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADDAKFVMS 137 DP V ++ ++ LR KPV AAV GAAAGAGF+LALACD V A F + Sbjct: 75 DPGVSFHTLAGQLNRVAVELRNMPKPVAAAVQGAAAGAGFTLALACDFRVMEKSAFFQQA 134 Query: 138 YARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKPGTARDAAV 197 Y GL DGGG++ L + + A E+ + I A + E G+V +L + G ARD A+ Sbjct: 135 YTSNGLCIDGGGTFTLPRLVGMARALEIAAFDERIPAEKALEWGLVTRLAEDGAARDEAL 194 Query: 198 AWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREGLEGISAFLEKR 257 + L + S +S AR K L A ER A H +G EG+ AF+EKR Sbjct: 195 DMLNRLAERSLHSFARCKDLFNRAFQNDFETQAERERRALAACARHEDGREGLRAFVEKR 254 Query: 258 APVY 261 P + Sbjct: 255 PPKF 258 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 259 Length adjustment: 25 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory