Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate WP_245795194.1 BUB04_RS13185 branched-chain amino acid ABC transporter permease
Query= uniprot:G8ALI9 (505 letters) >NCBI__GCF_900129305.1:WP_245795194.1 Length = 320 Score = 221 bits (564), Expect = 2e-62 Identities = 134/332 (40%), Positives = 179/332 (53%), Gaps = 28/332 (8%) Query: 155 AVVVALAFPFTPLADRQLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSY 214 AV+ P L +IG+ Y LG LN++VG AGL +LG+ AFYAVGAY+ Sbjct: 14 AVLALCPLVLNPYWTDVLNNIGL----YAALGLSLNLIVGHAGLFNLGHAAFYAVGAYTA 69 Query: 215 ALLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRIILIN-W 273 A+L F LPL A + +L+ P++ LRGDY IVT+G GEI+RI LIN Sbjct: 70 AILNTMFHIPVLALLPLCALTAGIFALLVAKPIIHLRGDYLCIVTIGVGEIVRIALINNI 129 Query: 274 YQFTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVLA 333 + TGG NGI GI RP+ FG+ R P HE F YLI Sbjct: 130 FGITGGANGIFGISRPNLFGLV--IRKP-------HEFF--------------YLIWFFV 166 Query: 334 LVVNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFAGSFFAT 393 F R+ GRA LRED+ A GI+ + KL AF I A + G G+ +A Sbjct: 167 AATAFFFHRLENSRFGRALNYLREDETAAEGSGIDTAHYKLMAFVIGAAWAGMVGNLYAA 226 Query: 394 RQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRMLAFGM 453 + ISPESF+F ES ++ +++LGG GS GV++ AFLVIGLPE FR + RM+ FG Sbjct: 227 KMTIISPESFSFWESVLMFTLIILGGSGSIPGVLLGAFLVIGLPEVFRGFTNARMMVFGA 286 Query: 454 GMVLIMLWRPRGLLAHRDPTILLHGRPKGGAG 485 M+ +M++R G+L + +L GR +G G Sbjct: 287 AMIAMMIFRTGGILPAKPRRYILPGREEGQGG 318 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 320 Length adjustment: 31 Effective length of query: 474 Effective length of database: 289 Effective search space: 136986 Effective search space used: 136986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory