Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_073040275.1 BUB04_RS13180 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_900129305.1:WP_073040275.1 Length = 301 Score = 273 bits (697), Expect = 5e-78 Identities = 146/312 (46%), Positives = 213/312 (68%), Gaps = 16/312 (5%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLL---KVV 57 M+ F QQ+ NGL +G +YALIALGYTMVYGVL LINFAHGD+ +G+ +GL+LL + Sbjct: 1 MEEFFQQLTNGLAVGGIYALIALGYTMVYGVLKLINFAHGDLFTIGSYLGLTLLTSLSLT 60 Query: 58 QQVAPGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQT 117 ++AP G++ L + ++G + V V L+ER+AYRPLR +PRL+ +++A+G SI Sbjct: 61 DRLAPAA-GVLVLAVMVMGLVAV---VGALLERVAYRPLRQSPRLSAVVSALGASIFFSN 116 Query: 118 LAMMIWGRSPLPFPQ-VMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRA 176 M+I+G +PQ ++P V+I G + +I++LA +V+ M+ L ++KT++G A Sbjct: 117 ALMLIYGARFQVYPQGILPKVAVNIFGLYVPLVRILILAASVVMMLALYFFIQKTRIGTA 176 Query: 177 MRATAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAF 236 +RA A + A LMG+D ++VI+ F IG L +AG+M +Y F MG+V GLKAF Sbjct: 177 IRAAAIDQDAARLMGIDVDRVILFVFLIGPALGGVAGLMVGLHYGQINFTMGWVYGLKAF 236 Query: 237 SAAVLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLR 296 +AA+LGGIGNI GAM+GGILLG+IE+LGA Y L ++D AF VLII+L +R Sbjct: 237 TAAILGGIGNIPGAMVGGILLGVIEALGAAY--------LSIAWKDAIAFGVLIIILIVR 288 Query: 297 PSGIMGERVADR 308 P+G++GERVA++ Sbjct: 289 PTGLLGERVAEK 300 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 301 Length adjustment: 27 Effective length of query: 282 Effective length of database: 274 Effective search space: 77268 Effective search space used: 77268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory