Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_073040757.1 BUB04_RS14535 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_900129305.1:WP_073040757.1 Length = 308 Score = 222 bits (565), Expect = 1e-62 Identities = 127/309 (41%), Positives = 186/309 (60%), Gaps = 15/309 (4%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLL-----K 55 M++F+Q ++N L GS YALIALGYT+VYGVL LINFAHGDI MVGA +G + K Sbjct: 1 MEVFLQNLLNALQWGSFYALIALGYTLVYGVLLLINFAHGDIFMVGAYIGFFVASFFLGK 60 Query: 56 VVQQVAPGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRN--APRLAPLITAIGVSI 113 + LP V ++ ++ + + VV + +ER+AYRPLR APRL +ITA+ + Sbjct: 61 YAFHLPLDLPPSVIFLLTLLLTMALTSVVGVTLERVAYRPLRRKGAPRLYVVITALMCGL 120 Query: 114 LLQTLAMMIWGRSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKM 173 LL+ + + G S FP+++P + G ++ +I+++ A+L V L +V KTK+ Sbjct: 121 LLENGNLALLGASRRSFPELLPKAVYDLGGVSVTNIKILVIIAALLVFVFLETVVRKTKL 180 Query: 174 GRAMRATAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGL 233 G AMRA + + LMG+ + VIV TF +G+ +AA+ GV++A Y + MG + G Sbjct: 181 GMAMRAISYDRMAVPLMGIPVDTVIVFTFVLGSSMAALGGVLFATAYPVLEPYMGALIGW 240 Query: 234 KAFSAAVLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVL 293 KAF AAV+GGIG I GA GG LLG IE A F S +D+ +F +L++ L Sbjct: 241 KAFIAAVIGGIGEIRGAFAGGFLLGFIEIFVAA--------FFPSTLRDLISFSILLVFL 292 Query: 294 TLRPSGIMG 302 ++RP+G G Sbjct: 293 SVRPTGFFG 301 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 308 Length adjustment: 27 Effective length of query: 282 Effective length of database: 281 Effective search space: 79242 Effective search space used: 79242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory