Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate WP_073040418.1 BUB04_RS13540 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_900129305.1:WP_073040418.1 Length = 401 Score = 313 bits (802), Expect = 6e-90 Identities = 175/393 (44%), Positives = 255/393 (64%), Gaps = 6/393 (1%) Query: 3 IKLEIKNLYKIFGE-HPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMG 61 +K++++NL+KIFG + A + + + L G ++ V+ + EGEIFVIMG Sbjct: 6 VKIQVRNLWKIFGNLSGEAAERLASDPEAALEDLSLNGCTVAVRAVDFHVNEGEIFVIMG 65 Query: 62 LSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHM 121 LSGSGKST++R LN +IEPT G+VLIDG + ++ LR +R++K+AMVFQ FAL+P+ Sbjct: 66 LSGSGKSTLLRCLNGIIEPTCGEVLIDGEGVGAMTPKRLRALRQQKMAMVFQHFALLPYR 125 Query: 122 TVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALAI 181 +VLDN AFG+EL G+ +ERR +A + L VGL ++ P ELSGGM+QRVGLARALA+ Sbjct: 126 SVLDNVAFGLELQGVGKKERRRRAREVLDLVGLADWERYLPAELSGGMQQRVGLARALAV 185 Query: 182 NPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNG 241 +P+ILLMDEAFSALDPLIR +MQDE +KL ++TIVFI+HDLDEA+R+ DRIA+M+ G Sbjct: 186 DPEILLMDEAFSALDPLIRRQMQDEFLKLVEIVKKTIVFITHDLDEALRLADRIAVMKEG 245 Query: 242 EVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRTPNGLIRKTPGFGPRSALK 301 +VQ+GTP++I+ +PA+DYV F V ++V +A++I P I PR L+ Sbjct: 246 RIVQIGTPEQIVMDPADDYVEEFVGAVSRTRVIAARNIMAE-PRPWI-SPQDRDPRELLR 303 Query: 302 LLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLD--AALIDAPLAVDAQTPLSEL 359 + + E +V + + VG ++ + L + + A + P AV PLSE+ Sbjct: 304 HMDRHNLECVFVTDAARRLVGVLTREELAGQGRPPRDAEPPARSVRVP-AVPPDAPLSEV 362 Query: 360 LSHVGQAPCAVPVVDEDQQYVGIISKGMLLRAL 392 + +PV+DE + +G+IS+ LLR L Sbjct: 363 VERAAATSKPIPVLDESGRILGVISRSRLLREL 395 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 401 Length adjustment: 31 Effective length of query: 369 Effective length of database: 370 Effective search space: 136530 Effective search space used: 136530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory