Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate WP_084076256.1 BUB04_RS06460 aspartate aminotransferase family protein
Query= BRENDA::Q9I6J2 (456 letters) >NCBI__GCF_900129305.1:WP_084076256.1 Length = 449 Score = 274 bits (700), Expect = 5e-78 Identities = 157/434 (36%), Positives = 241/434 (55%), Gaps = 15/434 (3%) Query: 21 HLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATR 80 H+ Y+ L +K ++ + EGVYIWD G + +D G V++G+G E+++A Sbjct: 5 HMKDHIFYRNL-KKTYPVVDRGEGVYIWDKNGKRYIDGSGGACVVSIGHGVPEILEAMKE 63 Query: 81 QMRELPFYNLFFQTAHPPVVELAKAIADVAPE-GMNHVFFTGSGSEANDTVLRMVRHYWA 139 Q R + F + T+ +E A+ + +AP+ +N V+F GSEA +T +++VR YW Sbjct: 64 QARRICFAHGSHFTSEA-ALECAERLVRMAPDPALNRVYFLSGGSEAVETAVKVVRQYWR 122 Query: 140 TKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMS 199 G+P K VI RW +HG+T ++LGG + HI Y Y Sbjct: 123 EVGKPDKYKVISRWTSFHGNTTGALALGGHTGRRKHYHPLFLHTPHIEPAYCYRCPFGRE 182 Query: 200 PDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGA-GGVIVPPDTYWPKIREILAKYDIL 258 P+ + A+QLE+ I G + VAAFIAEP+ GA G +VP D YW +IREI Y + Sbjct: 183 PEACSLECADQLERTIKYEGPDAVAAFIAEPVVGATAGALVPRDGYWQRIREICNAYQVK 242 Query: 259 FIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQG-G 317 IADEV+ G GRTG+ F ++ PD++ AKGL+SGY P+G V+V++EI + + G G Sbjct: 243 LIADEVMTGVGRTGQNFCLDHWKVVPDVIVTAKGLSSGYTPLGAVIVKEEIHDAIRSGSG 302 Query: 318 EFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARG 377 F HG TY +P++AA+ +R L E+ ++ + L ++ Q L +HP VG+ RG Sbjct: 303 AFVHGHTYCQNPLSAAIGAAVLRYLEEQNLVAR-SERMGKVLLEKLQVLLEHPTVGDVRG 361 Query: 378 VGMVAALELVKNKKTRERFTDK-GVGMLCREHCFRNGLIM--------RAVGDTMIISPP 428 +G+ A +ELV++KKT+ F + + FR GLI GD ++++PP Sbjct: 362 LGLFAGVELVRDKKTKATFDPSLKINARVAQEAFRRGLITYPGSGGADGIHGDHILLAPP 421 Query: 429 LVIDPSQIDELITL 442 VI SQID+L+ + Sbjct: 422 FVITESQIDDLVRI 435 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 588 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 449 Length adjustment: 33 Effective length of query: 423 Effective length of database: 416 Effective search space: 175968 Effective search space used: 175968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory