Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_073037017.1 BUB04_RS03595 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_900129305.1:WP_073037017.1 Length = 362 Score = 206 bits (524), Expect = 8e-58 Identities = 136/340 (40%), Positives = 192/340 (56%), Gaps = 24/340 (7%) Query: 16 VDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGERVND------ 69 + + +DL + +GPSGCGK+TLLR + GLE G++ I E V Sbjct: 19 IHALDRVDLTVPANHIFTLLGPSGCGKTTLLRCLVGLESPDEGEISIGEEVVWSREKGVF 78 Query: 70 VPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTPYLDR 129 VPP KRG+ MVFQ+YA++PHMTV+DN+A+ +++ R ++EI +V ++QL +R Sbjct: 79 VPPEKRGLGMVFQTYAIWPHMTVFDNVAYPLQVRRLPRDEIRSKVAAVLKLVQLDALENR 138 Query: 130 LPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSDTTMI 189 LSGGQ+QRVA+ RA+ PKV LFDEPLSNLDA LR TR E+ + + T + Sbjct: 139 PATKLSGGQQQRVALARALVAEPKVILFDEPLSNLDAKLREETRKELRQFLTELG-ITAV 197 Query: 190 YVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAMNVIPATI-T 248 YVTHD+VEA++L+D I V+ G I ++G+P ++Y + + FVA FIG N+IP T+ T Sbjct: 198 YVTHDRVEALSLSDSIAVMKDGQIVEIGSPQKIYFQAEHPFVADFIG--RANLIPGTVET 255 Query: 249 ATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDF-----LFEGTVS 303 AV GK + P A G + VRPE +RV AD F G V Sbjct: 256 REEDLVAVETPIGKVLAARGPKVA--RGDEVTVCVRPEFIRVV-ADPLAEGINTFSGVVE 312 Query: 304 IVEALGEVTLLYIEGLVE-NEPII-AKMPGIARVGRGDKV 341 + +GE EG V E ++ ++ RV RGD+V Sbjct: 313 SLVFVGEAH----EGEVRVGETLLNTRIDPDVRVRRGDRV 348 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 362 Length adjustment: 29 Effective length of query: 333 Effective length of database: 333 Effective search space: 110889 Effective search space used: 110889 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory