Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_073040757.1 BUB04_RS14535 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_900129305.1:WP_073040757.1 Length = 308 Score = 211 bits (537), Expect = 2e-59 Identities = 119/309 (38%), Positives = 180/309 (58%), Gaps = 12/309 (3%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLA----- 61 +LQ L+N L GS YALIA+GYT+VYG++ +INFAHG+++M+G+YI F + Sbjct: 4 FLQNLLNALQWGSFYALIALGYTLVYGVLLLINFAHGDIFMVGAYIGFFVASFFLGKYAF 63 Query: 62 MMGLDSVP-LMMLAAFAASIIVTSAFGYSIERVAYRPLR--GGNRLIPLISAIGMSIFLQ 118 + LD P ++ L ++ +TS G ++ERVAYRPLR G RL +I+A+ + L+ Sbjct: 64 HLPLDLPPSVIFLLTLLLTMALTSVVGVTLERVAYRPLRRKGAPRLYVVITALMCGLLLE 123 Query: 119 NAVMLSQDSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSR 178 N + + ++ P LLP + GV ++ ++IL+ + LV L + +++ Sbjct: 124 NGNLALLGASRRSFPELLPKAVY----DLGGVSVTNIKILVIIAALLVFVFLETVVRKTK 179 Query: 179 LGRACRACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAG 238 LG A RA + D L+GI + +I TFV+G+++AA+ VL Y V+ P +G L G Sbjct: 180 LGMAMRAISYDRMAVPLMGIPVDTVIVFTFVLGSSMAALGGVLFATAYPVLEPYMGALIG 239 Query: 239 IKAFTAAVLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGI 298 KAF AAV+GGIG I GA GG LLG E F A F +D+++F +L++ L RPTG Sbjct: 240 WKAFIAAVIGGIGEIRGAFAGGFLLGFIEIFVAAFFPSTLRDLISFSILLVFLSVRPTGF 299 Query: 299 LGRPEVEKV 307 G K+ Sbjct: 300 FGVARATKI 308 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 308 Length adjustment: 27 Effective length of query: 280 Effective length of database: 281 Effective search space: 78680 Effective search space used: 78680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory