Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_073037017.1 BUB04_RS03595 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_900129305.1:WP_073037017.1 Length = 362 Score = 202 bits (513), Expect = 2e-56 Identities = 128/322 (39%), Positives = 185/322 (57%), Gaps = 17/322 (5%) Query: 3 DLKLTGVEKAYGD----VKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGG 58 ++++TG+ K Y + L ++L + + +GPSGCGK+TLLR + GLE G Sbjct: 2 EIRITGLTKIYESEGKKIHALDRVDLTVPANHIFTLLGPSGCGKTTLLRCLVGLESPDEG 61 Query: 59 TLEIDGTVVND------VPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDA 112 + I VV VPP +RG+ MVFQ+YA++PHMTV +N+++ L++ + + EI + Sbjct: 62 EISIGEEVVWSREKGVFVPPEKRGLGMVFQTYAIWPHMTVFDNVAYPLQVRRLPRDEIRS 121 Query: 113 AVEAAAEKLQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVAT 172 V A + +QL +R LSGGQ+QRVA+ R++V +PKV LFDEPLSNLDA LR T Sbjct: 122 KVAAVLKLVQLDALENRPATKLSGGQQQRVALARALVAEPKVILFDEPLSNLDAKLREET 181 Query: 173 RLEIAQLKEAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVA 232 R E+ Q + T VYVTHD+VEA++L+ I V+ G I ++GSP ++Y + E+ FVA Sbjct: 182 RKELRQFLTEL-GITAVYVTHDRVEALSLSDSIAVMKDGQIVEIGSPQKIYFQAEHPFVA 240 Query: 233 QFIGSPKMNLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDM-VEA 291 FIG + NL+PG + T G+ ++ G V V VRPE + V A Sbjct: 241 DFIG--RANLIPGTVETREEDLVAVETPIGKVLA-ARGPKVARGDEVTVCVRPEFIRVVA 297 Query: 292 AP--GGDYVFEGKVAITEALGE 311 P G F G V +GE Sbjct: 298 DPLAEGINTFSGVVESLVFVGE 319 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 362 Length adjustment: 30 Effective length of query: 343 Effective length of database: 332 Effective search space: 113876 Effective search space used: 113876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory