Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_073037017.1 BUB04_RS03595 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_900129305.1:WP_073037017.1 Length = 362 Score = 193 bits (490), Expect = 7e-54 Identities = 123/356 (34%), Positives = 196/356 (55%), Gaps = 31/356 (8%) Query: 17 KHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDKLMNDAS--- 73 K ++++ +L + +GPSGCGK+T LR + GLE EG + I ++++ Sbjct: 18 KIHALDRVDLTVPANHIFTLLGPSGCGKTTLLRCLVGLESPDEGEISIGEEVVWSREKGV 77 Query: 74 ---PKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEILGLTEFLE 130 P+ R + MVFQ YA++PHM+V++N+A+ L++R+ +D+I +V +++ L Sbjct: 78 FVPPEKRGLGMVFQTYAIWPHMTVFDNVAYPLQVRRLPRDEIRSKVAAVLKLVQLDALEN 137 Query: 131 RKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTI 190 R LSGGQ+QRVA+ RA+V + KV L DEPLSNLDAKLR R E+ + +G T + Sbjct: 138 RPATKLSGGQQQRVALARALVAEPKVILFDEPLSNLDAKLREETRKELRQFLTELGITAV 197 Query: 191 YVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFIGSPA 250 YVTHD+ EA++L+D I +M G+I +IG+PQ++Y + + FVA FIG Sbjct: 198 YVTHDRVEALSLSDSIAVMKD----------GQIVEIGSPQKIYFQAEHPFVADFIG--R 245 Query: 251 MNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKG---YLGKKVTLGIRPEDISSDQIVH 307 N TVE +D +++ P G K+L +G G +VT+ +RPE I ++V Sbjct: 246 ANLIPGTVETR---EEDLVAVETPIG--KVLAARGPKVARGDEVTVCVRPEFI---RVVA 297 Query: 308 ETFPNASVTADILVSEL--LGSESMLYVKFGSTEFTARVNARDSHSPGEKVQLTFN 361 + T +V L +G V+ G T R++ G++V + F+ Sbjct: 298 DPLAEGINTFSGVVESLVFVGEAHEGEVRVGETLLNTRIDPDVRVRRGDRVGVRFD 353 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 362 Length adjustment: 30 Effective length of query: 347 Effective length of database: 332 Effective search space: 115204 Effective search space used: 115204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory