Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate WP_073036266.1 BUB04_RS01465 dihydrolipoamide acetyltransferase family protein
Query= reanno::Marino:GFF1672 (378 letters) >NCBI__GCF_900129305.1:WP_073036266.1 Length = 448 Score = 162 bits (411), Expect = 1e-44 Identities = 125/411 (30%), Positives = 197/411 (47%), Gaps = 42/411 (10%) Query: 2 TDKAMVEITAPKAGRVTKLYHQQQAMAKVHAPLFAFIPRDREEPEEAR---TKPEPAAQL 58 T K + AP G + ++ V + A I R+ EEPE + EP A Sbjct: 41 TSKITNSVEAPATGILFQILVPAGETVPVKT-VVAVIAREGEEPERREGPSLQSEPDAAA 99 Query: 59 STATASPVAAASRQR-IPASPAVRRLVREHELNLSDIQGSGKDGRVLKADVLAY---IEE 114 A + +R + A+P RRL +E L+L ++G+G +GR+ + DV Y E Sbjct: 100 REARKEKESGEARGSFVRATPIARRLAKEWGLDLGRVEGTGPEGRITEEDVRRYKERTEA 159 Query: 115 GPK---QAQNQAP--------------------ADDAQTATTRSARR--APAAD-----Q 144 GP QAQ A AD + R A R APAA Sbjct: 160 GPSISPQAQALAQKEGLDLSSVEGTGPDGKITKADVLRALEKRKAERSAAPAAPGITGPA 219 Query: 145 EARVEPIRGIKAAMAKSMVKSATTIPHFIYSEDIDVTDLLKLREQLKPE-AEARGSRLTL 203 V P+ G++ +A +M+ S ++D T+L +LR++L+ + A+ R++ Sbjct: 220 AGTVIPLEGMRKVIADNMMASLHQSAQLSVFVEVDATELKRLRDRLRLQCADQDLPRVSY 279 Query: 204 MPFFMKAMALAVQEFPVLNSQLNDDVTEIHYLPQCNIGMAVDGKAGLTVPNIKGVESLSL 263 A+ A+++ P++NS L +D +H N+G+AV GL VPN+K ++LS+ Sbjct: 280 NDLIAYAVCRALKKVPIMNSWLTEDGIVVH--DHVNLGIAVALPDGLIVPNVKNAQTLSV 337 Query: 264 LGIADEVARLTEAARSGRVSQEDLKGGTITISNIGALGGTYTAPIINAPEVAIVALGRTQ 323 L +A E+ +L AR GR+S ++++GGT TI+N+ LG PI+N PE I+ +GR Sbjct: 338 LELAREIRKLAAKAREGRLSIDEIQGGTFTITNVSMLGVDGFTPILNPPETGILGVGRAV 397 Query: 324 KLPRFDANGQVVERAIMTVSWAGDHRIIDGGTIARFCNRWKGYLESPQTML 374 + P G++ R +MT+S DHR+ DG F +LE P TM+ Sbjct: 398 EKPAVH-GGEICVRTLMTLSLTFDHRVTDGAPAMTFLRALADFLEDPATMI 447 Lambda K H 0.316 0.131 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 448 Length adjustment: 31 Effective length of query: 347 Effective length of database: 417 Effective search space: 144699 Effective search space used: 144699 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory