Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_073040761.1 BUB04_RS14545 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_900129305.1:WP_073040761.1 Length = 258 Score = 251 bits (640), Expect = 1e-71 Identities = 132/253 (52%), Positives = 171/253 (67%) Query: 1 MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTV 60 MALLE++ +T FGGL AV D L L GEL+GLIGPNGAGKTT+FNL+ G Y P+EG + Sbjct: 1 MALLEIRNMTHFFGGLRAVYDFNLRLEGGELMGLIGPNGAGKTTVFNLVCGFYRPTEGEI 60 Query: 61 TLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPA 120 +G G P+ + ++G+ RTFQNIRL+ L V DN+ I+ + + LR Sbjct: 61 LFEGKETAGLRPHAVTAMGIARTFQNIRLWNTLPVYDNLCISQHFRLGYGLKDALLRTRR 120 Query: 121 FYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAA 180 F EK + A ELL++ L A+ L NL YG QRRLEI RALAT PK+L LDEPAA Sbjct: 121 FTAREKNVHKTAEELLELMGLRHYAQELPGNLPYGLQRRLEIARALATRPKLLLLDEPAA 180 Query: 181 GMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIK 240 GMNP E +L +LIR I+++F +T+ LIEH M +VM V ER+ VL++G IA G+P+EIK Sbjct: 181 GMNPGEIDQLIDLIRWIREQFDLTVWLIEHHMRVVMSVCERVQVLDFGETIADGSPEEIK 240 Query: 241 TNKRVIEAYLGGE 253 N+RVI+AYLG E Sbjct: 241 QNRRVIQAYLGSE 253 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 258 Length adjustment: 24 Effective length of query: 230 Effective length of database: 234 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory