Align Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein, mitochondrial; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 (characterized)
to candidate WP_073041887.1 BUB04_RS17465 CoA ester lyase
Query= SwissProt::Q8R4N0 (338 letters) >NCBI__GCF_900129305.1:WP_073041887.1 Length = 315 Score = 130 bits (327), Expect = 4e-35 Identities = 94/310 (30%), Positives = 151/310 (48%), Gaps = 24/310 (7%) Query: 43 RRAVLYVPGNDEKKIRKIPSLKVDCAVLDCEDGVAENKKNEARLRIAKTLEDFDLGTTEK 102 RR++L VP N EK ++K L D +LD ED V +K+ AR + + L D + Sbjct: 8 RRSLLSVPANREKMVQKALGLPADVVMLDLEDSVPVEEKDSARGAVVEALRSGDWHGKVR 67 Query: 103 CVRINSVSSGLAEVDLETFLQA---RVLPSSLMLPKVEGPEEIRWFSDKFSLHLKGRKLE 159 R+N + + A D+ ++A RV +++PKV P EIR + + L+ Sbjct: 68 AYRMNDMGTPFAYRDVIDVVEAVGDRV--DVIVVPKVNDPAEIRALDYLLTQIEQRMGLK 125 Query: 160 QPMNLIPFVETAMGLLNFKAVCEETLKTGPQVGLCLDAVVFGGEDFRASIG----ATSNK 215 + L +ETA G+ + + + L+A+VFG D+ AS+G S Sbjct: 126 NRIGLEASIETAQGMARACEIAASSER--------LEALVFGVADYGASVGMPSRGVSGH 177 Query: 216 DTQDILYARQK-------VVVTAKAFGLQAIDLVYIDFRDEDGLLRQSREAAAMGFTGKQ 268 ++ Y + +V+ AKA GL A+D Y DFRDE+GL R + A+G+ GK Sbjct: 178 GDAEVDYPGHRWHYPLSHMVMAAKAAGLAALDAPYGDFRDEEGLRRSCALSRALGYDGKW 237 Query: 269 VIHPNQIAVVQEQFTPTPEKIQWAEELIAAFKEHQQLGKGAFTFRGSMIDMPLLKQAQNI 328 IHP Q+ + FTP E ++ A ++ A++E + G G+ G M+D ++ AQ Sbjct: 238 AIHPAQLEAINAVFTPEEEDVKRALRIVEAYEEARSRGAGSVAVDGKMVDAASVRLAQVT 297 Query: 329 VTLATSIKEK 338 V I++K Sbjct: 298 VASWRLIEQK 307 Lambda K H 0.319 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 315 Length adjustment: 28 Effective length of query: 310 Effective length of database: 287 Effective search space: 88970 Effective search space used: 88970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory