Align Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 (characterized)
to candidate WP_073036163.1 BUB04_RS01145 2-hydroxyacid dehydrogenase
Query= SwissProt::Q9UBQ7 (328 letters) >NCBI__GCF_900129305.1:WP_073036163.1 Length = 314 Score = 111 bits (278), Expect = 2e-29 Identities = 83/259 (32%), Positives = 127/259 (49%), Gaps = 16/259 (6%) Query: 72 GANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELA---VSLLLTTCRRLPE 128 G L++I VG++ + L ++RGI V P T A +A + L+L R P Sbjct: 59 GGRLRLIQQFGVGLEGVDLAAARERGISVANVPSDKTGNAASVAEWVIFLMLALARDFPS 118 Query: 129 AIEEVKNGGWTSWKPLWL-CGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQP 187 ++ + + L + G L VGI+G+G +G+AI RLK G+Q L R P Sbjct: 119 QLKNIAE------RKLGVPTGKTLFGKKVGIVGMGNLGKAITFRLKALGMQ-ILALKRHP 171 Query: 188 RPEEAAEFQAEFVSTPE----LAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINI 243 E +F+ P+ L + DF+++A LT T+ L K F MK A IN+ Sbjct: 172 GECEKLYELVDFLGGPDDLDKLLQEVDFLILAVPLTAETKNLIGKCEFSLMKPNAYLINV 231 Query: 244 SRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRN 303 SRG VV+ L +AL + +IA GLDV EP+ N PL N ++ PHI T + + Sbjct: 232 SRGPVVDYLALLEALENRQIAGVGLDVFWSEPIDPNDPLFRY-NVIVSPHIAGVTDLSLD 290 Query: 304 TMSLLAANNLLAGLRGEPM 322 +++ A N+ G+P+ Sbjct: 291 SIAKEVAENIDRLRLGKPL 309 Lambda K H 0.320 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 314 Length adjustment: 28 Effective length of query: 300 Effective length of database: 286 Effective search space: 85800 Effective search space used: 85800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory