Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate WP_073037912.1 BUB04_RS05960 alcohol dehydrogenase catalytic domain-containing protein
Query= CharProtDB::CH_000596 (353 letters) >NCBI__GCF_900129305.1:WP_073037912.1 Length = 343 Score = 169 bits (428), Expect = 1e-46 Identities = 100/319 (31%), Positives = 169/319 (52%), Gaps = 6/319 (1%) Query: 20 IKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEKPFILGHECAGEIAAV 79 +++ +P P +VL+++ A GIC SD+ TN IG V P I+GHE AG + V Sbjct: 14 LQVADVPRPQPGPRDVLVRMKAAGICYSDVSILTNRYIGRKPVPIPIIMGHEGAGIVEEV 73 Query: 80 GSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPPVDGAFVQYIKMRQDF 139 G+ V + G VA E CG+CE C+ G N+C D + + G F +Y + Sbjct: 74 GAEVQGLRPGTPVAFEVLSGCGKCEQCRIGFKNMCEDWEHMGI-TCHGTFAEYAVVPAHL 132 Query: 140 VFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMGMGPVGLMAVAAAKAFGAGT 199 V +P+ + + EAA +EP S+ + + PG T+AI+G G +G++ + A + GA Sbjct: 133 VHPMPEGMEFVEAAFLEPLSLTVRTLEYVRPLPGETVAILGPGALGMLHLQAFLSAGASM 192 Query: 200 IIVTDLEP--LRLEAAKKMGATHIINIREQDALEEIKTITNDRGVDVAWETAGNPAALQS 257 + V LE R E A+ +GA I+N+ E+D ++ I+ T RGVD+ ETA +P A + Sbjct: 193 VAVVGLEQDRKRFELARSLGAHCIVNLSERDPVQAIREATGGRGVDIVVETANSPNATRL 252 Query: 258 ALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYG-IFRYANTYPKGIEFLASGIVD 316 A G++ + GL E ++ + + ++G + + + + ++A+G VD Sbjct: 253 AFDLAAARGRVILFGL--YPEATISPVTMLRKGLTVHGDVAILPKHFLRAMNWIATGKVD 310 Query: 317 TKHLVTDQYSLEQTQDAME 335 K L+T ++ LE+ Q+A + Sbjct: 311 VKKLITRRFRLEEAQEAFD 329 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 343 Length adjustment: 29 Effective length of query: 324 Effective length of database: 314 Effective search space: 101736 Effective search space used: 101736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory