Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_073042225.1 BUB04_RS18395 3-oxoacyl-[acyl-carrier-protein] reductase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_900129305.1:WP_073042225.1 Length = 247 Score = 129 bits (325), Expect = 4e-35 Identities = 82/258 (31%), Positives = 127/258 (49%), Gaps = 22/258 (8%) Query: 8 KVCLVTGAGGNIGLATALRLAEEGTAIAL-LDMNREALEKAEASVREKGVEARSYVCDVT 66 KV +VTGA IG A AL AE GT + + ++A ++ +V E+G A DV Sbjct: 5 KVVMVTGASRGIGRAVALAFAEPGTTVVVNYRSGKDAAQETAGAVEERGARAVLCPFDVA 64 Query: 67 SEEAVIGTVDSVVRDFGKIDFLFNNAGY--QGAFAPVQDYPSDDFARVLTINVTGAFHVL 124 EAV VV G++D L NNAG F +++ +D+ +VL +N+ G F Sbjct: 65 DPEAVKSGFKEVVDSLGRLDVLVNNAGVTRDNVFPRLKE---EDWDQVLDVNLKGIFLCC 121 Query: 125 KAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNA 184 +A R M+ Q YGRI+N S+ G G P Y +K I+ LT + A +L NI VNA Sbjct: 122 QAAVRPMLKQRYGRIINITSVVGFTGNPGQCNYAAAKAGIMGLTRSLARELISRNITVNA 181 Query: 185 ISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFL 244 ++PGY + ++ P+ + ++ +P R G E+ V FL Sbjct: 182 VAPGY----------------IETEMTHALPEKAREALLTQIPAGRTGRPEEVAAAVRFL 225 Query: 245 LGDDSSFMTGVNLPIAGG 262 ++++++TG L + GG Sbjct: 226 ASEEAAYITGQVLHVNGG 243 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 247 Length adjustment: 24 Effective length of query: 238 Effective length of database: 223 Effective search space: 53074 Effective search space used: 53074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory