Align ABC transporter for L-Arginine, putative ATPase component (characterized)
to candidate WP_074201472.1 BUQ81_RS05850 ATP-binding cassette domain-containing protein
Query= reanno::BFirm:BPHYT_RS07685 (263 letters) >NCBI__GCF_900141795.1:WP_074201472.1 Length = 264 Score = 120 bits (301), Expect = 3e-32 Identities = 81/240 (33%), Positives = 132/240 (55%), Gaps = 13/240 (5%) Query: 22 GDNEVLKGVSLNANKGDVISIIGASGSGKSTFLRCINFLERPNAGQIVVDGEMVKTKTDR 81 G + G+SL +G + +I+G SG+GK+T L+ I P++G+I+ DG+ V R Sbjct: 15 GARRIFDGLSLTIREGQITAIMGPSGTGKTTLLKLIAGQLTPDSGRILFDGQDVHAL--R 72 Query: 82 AGNLEVADHKQLQRIRTKLAMVFQHFNLWAHMNVLENIVEAPIHVLGLKRKEAEDRAREY 141 G +L R+R ++ M+FQ L +NV +N+ L E Sbjct: 73 RG--------ELFRLRQRMGMLFQSGALLTDLNVFDNVAFPLREHTKLPEVLIEKLVLMK 124 Query: 142 LEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMNPDVMLFDEPTSALDPELVGEVLKVM 201 L+ VGL S LSGG +RVA+ARA+AM+P+V+++DEP DP +G +LK++ Sbjct: 125 LQAVGLRGARHLM-ASELSGGMARRVALARAIAMDPEVVMYDEPFVGQDPITMGVLLKLI 183 Query: 202 QKLAEE-GRTMIVVTHEMGFARNVSNHVMFLHQGRTEEEGLPAEVLSAPRSERLKQFLSG 260 Q+L E G T IVV+H++ +++++V + +GR EG AE ++ ++QFL+G Sbjct: 184 QRLNESLGLTSIVVSHDVQEVMSIAHYVYVISEGRVVAEG-AAEEVAQSEQPYVRQFLNG 242 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 264 Length adjustment: 25 Effective length of query: 238 Effective length of database: 239 Effective search space: 56882 Effective search space used: 56882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory