Align succinate-semialdehyde dehydrogenase (NADP+) (EC 1.2.1.79) (characterized)
to candidate WP_074201782.1 BUQ81_RS07630 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::B1XMM6 (454 letters) >NCBI__GCF_900141795.1:WP_074201782.1 Length = 458 Score = 432 bits (1110), Expect = e-125 Identities = 226/452 (50%), Positives = 295/452 (65%), Gaps = 2/452 (0%) Query: 5 TINPTTGEICQRFKALTPAEIDAKLAKAQEAFQAY-RRTSFSQRRQWLENAAAILERDTS 63 +INP T E R ++D L A A + + ++T R + L N A +L Sbjct: 7 SINPATEEENARIPVWDDDKLDTALRYAGYAQRDWAQQTPLETRCELLRNVAELLRVKKR 66 Query: 64 KFAEIMTTEMGKTHQSAIAEAEKSALVCRYYAEHGEQFLANEYTETQATESYVCYQPLGI 123 + AE+ T EMGK A AE EK A VC +YA+ LA+E ET+AT S V YQPLG+ Sbjct: 67 ELAELATREMGKRIGEAEAEVEKCAWVCDFYADQAPAMLADEVVETEATRSLVVYQPLGV 126 Query: 124 LLAVMPWNFPFWQVFRFAAPALMAGNVAVLKHASNVPQCALAVEAILEAAGFPEGVFQTL 183 +LAVMPWNFP+WQVFR AAPAL+AGN VLKHASNVP CALA+E + + AGFPE +FQ+L Sbjct: 127 ILAVMPWNFPYWQVFRAAAPALVAGNGVVLKHASNVPLCALAIEGLFKEAGFPEDLFQSL 186 Query: 184 LIGASQVEQVIKDPRVKAATLTGSEPAGASLASLAGQEIKPTLLELGGSDPFVVFPSADL 243 +I ++QVE+ I P V+ TLTGSEPAG ++AS+AG+E+K T+LELGGSDPFV+ P ADL Sbjct: 187 MITSAQVERAICHPDVRGVTLTGSEPAGRAVASIAGRELKKTVLELGGSDPFVILPDADL 246 Query: 244 DEAVEVGTVARTMNNGQSCIAAKRFILHEAIAAEFLEKLHLKFASLKI-GDPMAPETDIG 302 DE V + AR +N GQSCIAAKRF++ + + EF+ + + + GDPM P T +G Sbjct: 247 DEVVPMALKARFINMGQSCIAAKRFLVDKTMHDEFVARFKVAIEDYFVPGDPMDPATTLG 306 Query: 303 PLATEGILQDISRQVDQAVAAGAKILLGGRPLDRAGYFYPPTILTEIPPGAKILQEELFA 362 P+A +++++ QV +A GA + GG+ LDR G +Y PT+LT + QEELF Sbjct: 307 PMARRDLMEELHNQVIRAQDYGATVETGGQTLDRPGAYYAPTLLTNVTTSNPAFQEELFG 366 Query: 363 PVAMVFTVKDLDQAIALANDIPFGLGASAWTNDPAEQQRFIQELDAGAVFINGMVKSDPR 422 PVA V T + A+ LAN FGLG S WT D A + + + G F+N MV+SDPR Sbjct: 367 PVATVTTYTEPSHALGLANATRFGLGGSVWTTDIATGEAIARGMQCGCAFVNDMVRSDPR 426 Query: 423 LPFGGTKRSGYGRELGLAGIRTFVNAKTVWLK 454 LPFGG K SGYGREL + GIR FVN KT+W+K Sbjct: 427 LPFGGIKDSGYGRELSVYGIREFVNIKTLWIK 458 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 30 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 458 Length adjustment: 33 Effective length of query: 421 Effective length of database: 425 Effective search space: 178925 Effective search space used: 178925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory