Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_074200832.1 BUQ81_RS02650 lipoprotein-releasing ABC transporter ATP-binding protein LolD
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_900141795.1:WP_074200832.1 Length = 227 Score = 120 bits (301), Expect = 3e-32 Identities = 83/219 (37%), Positives = 120/219 (54%), Gaps = 17/219 (7%) Query: 7 KKLVKRY--GALE--VVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEI 62 + LVK Y G E V+ G+ L + RE +A+VG SG GKST L ++ GL+ + G + + Sbjct: 9 RNLVKTYRDGPAETPVLKGVSLILHRRERVAIVGSSGSGKSTLLHLLGGLDRPTDGEVLL 68 Query: 63 GGRKVNDLPPRAR------NISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAE 116 G+ + L AR ++ V+Q + L P +T EN+ L I E T + Sbjct: 69 LGQPFSKLGEAARGRLRNRHMGFVYQFHHLLPELTAEENVMMPLLIR---RESEATARDK 125 Query: 117 AAAILDLAHLLER---RPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVR 173 A A+LD L R +PS+LSGG+RQRVA+ RA+V +PD L DEP NLD++ QV Sbjct: 126 ALALLDAVGLSRRTAHKPSELSGGERQRVALARALVTEPDCVLADEPTGNLDSRSAEQVL 185 Query: 174 TEIKKLHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHI 212 + + L+ R ++ VTHD V DR + +RDG I Sbjct: 186 SLMDDLNQRFGTALLVVTHD-VNIAARMDRTLTLRDGMI 223 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 227 Length adjustment: 26 Effective length of query: 339 Effective length of database: 201 Effective search space: 68139 Effective search space used: 68139 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory