Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_074201862.1 BUQ81_RS07840 SDR family oxidoreductase
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_900141795.1:WP_074201862.1 Length = 269 Score = 103 bits (257), Expect = 4e-27 Identities = 76/250 (30%), Positives = 117/250 (46%), Gaps = 2/250 (0%) Query: 8 FPDLRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQTGQAPHF 67 +P+L ++ VL+TG SGIGA + AR+G R+ E+ + G Sbjct: 5 YPELNNKRVLITGASSGIGAGIARVLAREGCRLVLHYNRNEAGIEKTLSDVQALGAEAEV 64 Query: 68 IQADLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDR-QALEAVTEESWDESLSVNLRHL 126 + D R ++ V + A + L+NNA + +L+ E++DE L+VNL+ Sbjct: 65 LHCDFRELDRVVPFFEAAWQAFNGLDALINNAGIVSKVTSLKDPHGEAFDEVLAVNLQAP 124 Query: 127 FFMCQAVAPHMQRQG-GGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDN 185 + + A A H G GG +VN SSI + AY AKAG+ LT+ A + GP Sbjct: 125 YRLATAFAQHCIEAGHGGVVVNNSSIHGQKSCEWFSAYGAAKAGLDRLTEVQAIEWGPHG 184 Query: 186 IRVNAILPGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAAMT 245 IR+ I PG++ ER + R + L R D++ FL SD +A MT Sbjct: 185 IRLVGIAPGVVPVERTEVILSQPPVKDRWMKCTPLGRYGTTDEMGEAVAFLISDRAAWMT 244 Query: 246 AQAMIIDGGV 255 + +DGG+ Sbjct: 245 GSILTVDGGL 254 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 269 Length adjustment: 25 Effective length of query: 231 Effective length of database: 244 Effective search space: 56364 Effective search space used: 56364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory