Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_074201472.1 BUQ81_RS05850 ATP-binding cassette domain-containing protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900141795.1:WP_074201472.1 Length = 264 Score = 130 bits (327), Expect = 4e-35 Identities = 76/228 (33%), Positives = 129/228 (56%), Gaps = 1/228 (0%) Query: 2 VRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGE 61 +R ++ + F +G D +++ I G+ I+GPSG GKTT +++IAG P +G Sbjct: 1 MRTLIDVDNLTFSRGARRIFDGLSLTIREGQITAIMGPSGTGKTTLLKLIAGQLTPDSGR 60 Query: 62 LYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLT-NMKMSKEEIRKR 120 + FD + V + + + +++GM+FQ+ AL +L F+N+AFPL + K+ + I K Sbjct: 61 ILFDGQDVHALRRGELFRLRQRMGMLFQSGALLTDLNVFDNVAFPLREHTKLPEVLIEKL 120 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 V + + + + ELSGG +RVALARA+ DP +++ DEPF D Sbjct: 121 VLMKLQAVGLRGARHLMASELSGGMARRVALARAIAMDPEVVMYDEPFVGQDPITMGVLL 180 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDL 228 L++ + LG+T +VVSHD ++ +IA V V+ +G++V G E++ Sbjct: 181 KLIQRLNESLGLTSIVVSHDVQEVMSIAHYVYVISEGRVVAEGAAEEV 228 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 264 Length adjustment: 27 Effective length of query: 326 Effective length of database: 237 Effective search space: 77262 Effective search space used: 77262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory