Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_074201477.1 BUQ81_RS05880 LPS export ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_900141795.1:WP_074201477.1 Length = 241 Score = 123 bits (308), Expect = 4e-33 Identities = 72/221 (32%), Positives = 119/221 (53%), Gaps = 7/221 (3%) Query: 20 ILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIVR 79 +++ ++ + G++V ++GPNGAGK+T + GL+ +G+I IT R Sbjct: 18 VVKAVDIDVYSGQVVGLLGPNGAGKTTTFYMMMGLVPTDKGQIFIDDREITDAPIHVRAR 77 Query: 80 RGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTM-----FPKLAQRRNQRA 134 G+ Y+PQ +VF LTV EN+ A L P T DR + + ++A +Q Sbjct: 78 AGIGYLPQEASVFRRLTVRENIL--AILEMRPELTRADREAKLTDLLDWLQIAHIEDQPG 135 Query: 135 GTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAINATGKAIILVEQ 194 LSGGER+ + + RAL +P +LLDEP A + PI VK++ + I+ + G I++ + Sbjct: 136 QALSGGERRRVEIARALAAEPRFILLDEPFAGVDPISVKEIQSIIEQLKQEGIGILITDH 195 Query: 195 NAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLG 235 N ++ L + D Y+L +G +GS +L + V + YLG Sbjct: 196 NVRETLSVCDTAYILADGHILAQGSPTDILANQAVRDHYLG 236 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 241 Length adjustment: 23 Effective length of query: 217 Effective length of database: 218 Effective search space: 47306 Effective search space used: 47306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory