Align Broad specificity amino-acid racemase; Broad spectrum racemase; EC 5.1.1.10 (characterized)
to candidate WP_074201279.1 BUQ81_RS05015 alanine racemase
Query= SwissProt::Q88GJ9 (409 letters) >NCBI__GCF_900141795.1:WP_074201279.1 Length = 353 Score = 113 bits (282), Expect = 1e-29 Identities = 106/342 (30%), Positives = 158/342 (46%), Gaps = 35/342 (10%) Query: 44 AWVEVSASALQHNIRTLQAELAGKSKLCAVLKADAYGHGIGLVMPSIIAQGVPCVAVASN 103 A + + +A +HN++ +A L + AV+KAD YGHG L+ + AVAS Sbjct: 4 ARISLDGAAARHNLKHAKA-LNNHQPVWAVIKADGYGHG--LLWAANAFSDADGFAVASV 60 Query: 104 EEARVVRASGFTGQLVRVR---LASLSELEDGLQ-----YDMEELVGSAEFARQADAIAA 155 +EA +R GF ++ + A +EL D L +D ++ A FA +A I Sbjct: 61 DEAIALREGGFDQPILLLEGLFSADEAELADALNLQLVVHDPVQIDWLAAFAPEAPWIL- 119 Query: 156 RHGKTLRIHMALNSSGMSRNGVEMATWSGRGEALQITDQKHLKLVALMTHFAVEDKDDV- 214 L++ +GM R G+ + Q+ Q + L++HFA D D Sbjct: 120 ----WLKV-----DTGMHRLGISFEACART--IAQLRQQLPNAQLNLLSHFACADSDPTF 168 Query: 215 -RKGLAAFNEQTDWLIKHARLDRSKLTLHAANSFATLEVPEARLDMVRTGGALFGDTVPA 273 + L F I H + + ANS A + VP AR+ R G L+G T P Sbjct: 169 TAEQLKRFG------ICHDTVKNEIGAVSLANSAALIGVPAARIGWTRPGIMLYGAT-PL 221 Query: 274 RTEYKRAMQFKSHVAAVHSYPAGNTVGYDRTFTLARDSRLANITVGYSDGYRRVFTNKGH 333 + + M F S + AV G VGYD T+ RDS + + GY DGY R Sbjct: 222 DSRLRPVMHFHSALIAVKLIRQGEGVGYDLTWRAQRDSIIGIVAAGYGDGYPRHARTGTP 281 Query: 334 VLINGHRVPVVGKVSMNTLMVDVTDFP---DVKGGNEVVLFG 372 V + G RVP++G+VSM+ L VD+TD P ++ G+ V L+G Sbjct: 282 VWVEGARVPLIGRVSMDMLCVDLTDHPRKSHLQIGSPVELWG 323 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 353 Length adjustment: 30 Effective length of query: 379 Effective length of database: 323 Effective search space: 122417 Effective search space used: 122417 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory