Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_074201862.1 BUQ81_RS07840 SDR family oxidoreductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_900141795.1:WP_074201862.1 Length = 269 Score = 110 bits (276), Expect = 2e-29 Identities = 82/252 (32%), Positives = 119/252 (47%), Gaps = 22/252 (8%) Query: 16 LDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVG-EGAARELDGTFERLNVTDA 74 L+ + L+TG + GIG IAR LA+ G R+ + + G E ++ V Sbjct: 8 LNNKRVLITGASSGIGAGIARVLAREGCRLVLHYNRNEAGIEKTLSDVQALGAEAEVLHC 67 Query: 75 DAVADLARRLP----------DVDVLVNNAGIVRNAPA-EDTPDDDWRAVLSVNLDGVFW 123 D +L R +P +D L+NNAGIV + +D + + VL+VNL + Sbjct: 68 D-FRELDRVVPFFEAAWQAFNGLDALINNAGIVSKVTSLKDPHGEAFDEVLAVNLQAPYR 126 Query: 124 CCREFGRTMLARGRGAIVSTASMSGLISNHPQPQ----AAYNASKAAVIHLTRSLAGEWA 179 F + + G G +V S S H Q +AY A+KA + LT A EW Sbjct: 127 LATAFAQHCIEAGHGGVVVNNS-----SIHGQKSCEWFSAYGAAKAGLDRLTEVQAIEWG 181 Query: 180 SRGVRVNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAAS 239 G+R+ +APG T L P ++ W+K TPLGR E+ AV +L SD A+ Sbjct: 182 PHGIRLVGIAPGVVPVERTEVILSQPPVKDRWMKCTPLGRYGTTDEMGEAVAFLISDRAA 241 Query: 240 FVTGHTLVVDGG 251 ++TG L VDGG Sbjct: 242 WMTGSILTVDGG 253 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 269 Length adjustment: 25 Effective length of query: 230 Effective length of database: 244 Effective search space: 56120 Effective search space used: 56120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory