Align ABC transporter (characterized, see rationale)
to candidate WP_074200832.1 BUQ81_RS02650 lipoprotein-releasing ABC transporter ATP-binding protein LolD
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_900141795.1:WP_074200832.1 Length = 227 Score = 124 bits (312), Expect = 2e-33 Identities = 75/205 (36%), Positives = 114/205 (55%), Gaps = 9/205 (4%) Query: 18 ILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDLEPRERG- 76 +L+ VSL + E V VG SG GKSTLL L+ GLD G++L+ G+ + L RG Sbjct: 24 VLKGVSLILHRRERVAIVGSSGSGKSTLLHLLGGLDRPTDGEVLLLGQPFSKLGEAARGR 83 Query: 77 -----VGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQLDKLLQRKP 131 +G V+Q + L P ++ +N+ L + + + + R++ L + L + KP Sbjct: 84 LRNRHMGFVYQFHHLLPELTAEENVMMPLLIRRESEATARDKALALLDAVGLSRRTAHKP 143 Query: 132 KELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGSTMIYVT 191 ELSGG+RQRVA+ RA+ EPD +L DEP NLD+ Q+ + + L+ R G+ ++ VT Sbjct: 144 SELSGGERQRVALARALVTEPDCVLADEPTGNLDSRSAEQVLSLMDDLNQRFGTALLVVT 203 Query: 192 HDQVEAMTLADKIVVLNGG--RVEQ 214 HD V D+ + L G RVE+ Sbjct: 204 HD-VNIAARMDRTLTLRDGMIRVEE 227 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 227 Length adjustment: 26 Effective length of query: 355 Effective length of database: 201 Effective search space: 71355 Effective search space used: 71355 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory