Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_074200726.1 BUQ81_RS02070 molybdenum ABC transporter ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >NCBI__GCF_900141795.1:WP_074200726.1 Length = 356 Score = 116 bits (291), Expect = 8e-31 Identities = 85/239 (35%), Positives = 123/239 (51%), Gaps = 13/239 (5%) Query: 33 ILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPKDRDIAMVFQSYAL 92 +L GPSG GK+T L +AGL G + GD+ + FVPP R +++VFQ L Sbjct: 30 MLFGPSGSGKSTLLMALAGLLH-GEGVVAHGDQCWQASARRCFVPPHRRPLSVVFQDGRL 88 Query: 93 YPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQRVALGR 152 + HM+V +N+ F + I V V + LG+ L R+P++LSGGQRQRVAL R Sbjct: 89 FEHMSVEENLRFAWQ-HGHGATPIAWDV--VVDGLGIAPWLKRRPQQLSGGQRQRVALAR 145 Query: 153 AIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAV 212 ++ +P +DEPLS LDA R + A L+ L+ L + ++VTH E +GD++ Sbjct: 146 GLLVRPAWLFLDEPLSALDAPARSEILALLEGLKADLELPMLWVTHSIEEVERLGDQVVF 205 Query: 213 MNRGVLQQVGSPDEVYDKPANTFVAGFIGSPPMNFLDAIVTE--DGF----VDFGEFRL 265 M+ G LQ S +P F P+ L V+ DG+ + GE RL Sbjct: 206 MDSGQLQPPQSLQAAIRQPGTPL---FREEAPVALLTGTVSVPCDGYGLSQLQLGESRL 261 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 356 Length adjustment: 29 Effective length of query: 343 Effective length of database: 327 Effective search space: 112161 Effective search space used: 112161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory