Align Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized)
to candidate WP_074200832.1 BUQ81_RS02650 lipoprotein-releasing ABC transporter ATP-binding protein LolD
Query= SwissProt::P9WQI3 (393 letters) >NCBI__GCF_900141795.1:WP_074200832.1 Length = 227 Score = 114 bits (286), Expect = 2e-30 Identities = 69/211 (32%), Positives = 115/211 (54%), Gaps = 10/211 (4%) Query: 11 KSYPDGHT---AVRDLNLTIADGEFLILVGPSGCGKTTTLNMIAGLEDISSGELRIAGE- 66 K+Y DG ++ ++L + E + +VG SG GK+T L+++ GL+ + GE+ + G+ Sbjct: 13 KTYRDGPAETPVLKGVSLILHRRERVAIVGSSGSGKSTLLHLLGGLDRPTDGEVLLLGQP 72 Query: 67 --RVNEKAP---KDRDIAMVFQSYALYPHMTVRQNIAFPLTLAKMRKADIAQKVSETAKI 121 ++ E A ++R + V+Q + L P +T +N+ PL + + +A K Sbjct: 73 FSKLGEAARGRLRNRHMGFVYQFHHLLPELTAEENVMMPLLIRRESEATARDKALALLDA 132 Query: 122 LDLTNLLDRKPSQLSGGQRQRVAMGRAIVRHPKAFLMDEPLSNLDAKLRVQMRGEIAQLQ 181 + L+ KPS+LSGG+RQRVA+ RA+V P L DEP NLD++ Q+ + L Sbjct: 133 VGLSRRTAHKPSELSGGERQRVALARALVTEPDCVLADEPTGNLDSRSAEQVLSLMDDLN 192 Query: 182 RRLGTTTVYVTHDQTEAMTLGDRVVVMYGGI 212 +R GT + VTHD A + DR + + G+ Sbjct: 193 QRFGTALLVVTHDVNIAARM-DRTLTLRDGM 222 Lambda K H 0.319 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 227 Length adjustment: 26 Effective length of query: 367 Effective length of database: 201 Effective search space: 73767 Effective search space used: 73767 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory