GapMind for catabolism of small carbon sources

 

Protein WP_072908771.1 in Malonomonas rubra DSM 5091

Annotation: NCBI__GCF_900142125.1:WP_072908771.1

Length: 575 amino acids

Source: GCF_900142125.1 in NCBI

Candidate for 12 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-fructose catabolism fruA hi Fructose PTS Enzyme IIBC, FruA (characterized) 59% 98% 664.8 The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system 44% 420.2
sucrose catabolism fruA hi Fructose PTS Enzyme IIBC, FruA (characterized) 59% 98% 664.8 The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system 44% 420.2
D-fructose catabolism fruII-ABC med The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system (characterized) 44% 83% 420.2 Fructose PTS Enzyme IIBC, FruA 59% 664.8
sucrose catabolism fruII-ABC med The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system (characterized) 44% 83% 420.2 Fructose PTS Enzyme IIBC, FruA 59% 664.8
D-mannose catabolism manP med protein-Npi-phosphohistidine-D-mannose phosphotransferase (EC 2.7.1.191) (characterized) 43% 72% 387.1 Fructose PTS Enzyme IIBC, FruA 59% 664.8
xylitol catabolism fruI med The fructose inducible fructose/xylitol porter, FruI (characterized) 41% 80% 350.5 Fructose PTS Enzyme IIBC, FruA 59% 664.8
D-fructose catabolism fruII-C med Sugar phosphotransferase system IIC component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized) 46% 92% 305.4 Fructose PTS Enzyme IIBC, FruA 59% 664.8
sucrose catabolism fruII-C med Sugar phosphotransferase system IIC component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized) 46% 92% 305.4 Fructose PTS Enzyme IIBC, FruA 59% 664.8
D-fructose catabolism fruII-B med Phosphotransferase system IIB component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized) 47% 87% 109.4 Fructose PTS Enzyme IIBC, FruA 59% 664.8
sucrose catabolism fruII-B med Phosphotransferase system IIB component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized) 47% 87% 109.4 Fructose PTS Enzyme IIBC, FruA 59% 664.8
D-ribose catabolism fru2-IIB med PTS system, fructose-specific, IIB component, component of D-allose/D-ribose transporting Enzyme II complex (Fru2; IIA/IIB/IIC) (Patron et al. 2017). This system is similar to Frz of E. coli (TC#4.A.2.1.9) which is involved in environmental sensing, host adaptation and virulence (characterized) 42% 96% 83.6 Fructose PTS Enzyme IIBC, FruA 59% 664.8
D-ribose catabolism fru2-IIC lo PTS system, fructose-specific, IIC component, component of D-allose/D-ribose transporting Enzyme II complex (Fru2; IIA/IIB/IIC) (Patron et al. 2017). This system is similar to Frz of E. coli (TC#4.A.2.1.9) which is involved in environmental sensing, host adaptation and virulence (characterized) 37% 90% 227.6 Fructose PTS Enzyme IIBC, FruA 59% 664.8

Sequence Analysis Tools

View WP_072908771.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSKIVAVTACPTGVAHTFMAAEALKKVADTMGHELELETQGSEGAKDVLAPDAIAQADVV
IIAADIHVDPSRFAGKAIHAVSTSDAIRQTKEVIEAAFAEASQYREEVPQTADGEKFIVG
VTSCPTGIAHTFMAAEALKKAAEELGHEVKIETQGSVGAKNVLSDDEIARADAVIIAADA
FVDKTRFSGKPLFETSTKEALHNGANAIQAALSAAPAAKGLAKQVDDLKSERSAQRTGPY
RHLMTGVSYMLPVVVAGGLLIALAFAFGGIYAGDNEGTLGWALMQIGGATAFKLFVPVLG
AFIAYSIAERPGIAPGLIGGLLATTVGSGFLGGIVAGFLAGYLTKFLNDKIQLPQNLQGL
KPVLILPFLSTLIVGLLMIYVIGPPVNVVLTAMTDWLQGMQSTSSLVLGLILGAMMAFDM
GGPVNKAAYTFGVGLLSSQIYGPMAAIMAAGMVPPLGLALAATLFKNRFTDDEQEASKAA
FVLGISFITEGAIPFAARDPFRVIPCIMLGSAVTGALSMVFGAALMVPHGGIFVLFIPNA
VTQLVPYAVAILVGMLVTAAALFALKKPISAGNAI

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory