Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_072909153.1 BUB13_RS12765 ATP-binding cassette domain-containing protein
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_900142125.1:WP_072909153.1 Length = 695 Score = 223 bits (567), Expect = 1e-62 Identities = 118/234 (50%), Positives = 160/234 (68%), Gaps = 3/234 (1%) Query: 1 MLKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITF 60 MLK++ + YGA +AL GVD+EI GE V+L+GANGAGKSTLL + G + G I Sbjct: 1 MLKINNLTAHYGAAQALFGVDLEISTGETVALVGANGAGKSTLLKCLMGLVKPTGGEILL 60 Query: 61 EGQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAK--PGSFANELERVLT 118 +G+ +T ++VRLG+A SPEGR +FP +SV ENLQ+G+I K A +E V Sbjct: 61 DGKPVTGKNPAQMVRLGLALSPEGREVFPELSVRENLQLGAIPLKLSKAEEAERIEEVFD 120 Query: 119 LFPRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKD 178 FP+L+ER Q AGT+SGGEQQMLAIGRALM++PR+LLLDEPSLG+AP++ +IF + Sbjct: 121 RFPKLRERHLQLAGTLSGGEQQMLAIGRALMAKPRILLLDEPSLGIAPIITDEIFAIIHQ 180 Query: 179 INREQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 ++R T+ +VEQNA AL + R Y++ NGK+ G ELL + +RSA+L Sbjct: 181 LSR-SGTTILLVEQNAARALSGSDRAYLLANGKIVEQGKSDELLNDPILRSAFL 233 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 695 Length adjustment: 31 Effective length of query: 205 Effective length of database: 664 Effective search space: 136120 Effective search space used: 136120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory