Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate WP_072905066.1 BUB13_RS01985 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:G8ALJ3 (366 letters) >NCBI__GCF_900142125.1:WP_072905066.1 Length = 371 Score = 213 bits (543), Expect = 5e-60 Identities = 126/369 (34%), Positives = 195/369 (52%), Gaps = 6/369 (1%) Query: 4 KLSLLVAVAATAM---TASVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGG 60 K ++L++ AA + TA A I + AGP +G A +G K + V INAAGG Sbjct: 3 KFTVLLSTAALLLSLATAGFAADTIKLGVAGPHSGDLAPYGIPSMKAAQLVVKKINAAGG 62 Query: 61 VLGQKLKLEVGDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQIS 120 VLG++++L + DD C P+ A A +L G V GH CSG++ A +Y + V +S Sbjct: 63 VLGKQVELLIQDDQCKPEMATNAATKLVTDGAHVVLGHICSGATKAALGIYNDAKVPVMS 122 Query: 121 PASTNPKLTEQ-NLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADE 179 P++TNP LT+ + N FR DD Q ++A + + + K VA+LHDK YGKG A+ Sbjct: 123 PSATNPALTQSGDYPNFFRTIASDDMQARMAVDFTINDLGMKKVAVLHDKGDYGKGFAEF 182 Query: 180 TQKALNAGGQKEKI-YEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQ 238 +K L G+ E + +E T G DYS+++ K+++E + + GGYH EA + QMK + Sbjct: 183 AKKFLEESGKAEVVLFEGVTPGAMDYSSIIQKVRREKAEALIWGGYHPEASKIVAQMKRK 242 Query: 239 GLNAPIVSGDALVTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFR-KAGYEPEGY 297 + A VS D + + + + G + E MT D K A ++F+ + G +P + Sbjct: 243 RMKAAFVSDDGVKDDSFLKVAGKSAEGAYMTGPRDLSGNALNKAANDEFKAEYGADPGAF 302 Query: 298 TLYTYAALQIWAEAAKQANSTDSAKIADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRW 357 Y+A A ++A +TD K+ LR T +GKI FDA+GD + Y Sbjct: 303 FQEGYSAALALLNAIEKAGTTDYDKVVAALRTEYVETPVGKIKFDARGDAEGVGFSVYTV 362 Query: 358 NNGQYAQVK 366 NG + ++K Sbjct: 363 ENGAFKELK 371 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 371 Length adjustment: 30 Effective length of query: 336 Effective length of database: 341 Effective search space: 114576 Effective search space used: 114576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory