Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_072910073.1 BUB13_RS17580 aspartate carbamoyltransferase catalytic subunit
Query= curated2:A4XLM2 (308 letters) >NCBI__GCF_900142125.1:WP_072910073.1 Length = 310 Score = 130 bits (326), Expect = 5e-35 Identities = 98/314 (31%), Positives = 157/314 (50%), Gaps = 23/314 (7%) Query: 2 RHFLSLNELTKDEILYLVDLACRLKSEVKRGFF-FPYLKHKALGLIFTKASTRTRVSFEV 60 +H + + +LT +E+ +++D + K +R P L+ K + +F +ASTRTR SFE+ Sbjct: 6 KHIIGIKDLTPEELTFILDTSISFKEINRRDIKKVPTLRGKTIINLFFEASTRTRTSFEI 65 Query: 61 GINQLGGYSLYLSKNDLQLGRGETIEDTAK-VLSRYLDLIVIRTYAQSEVEEFAKYSSIP 119 +L ++ +S + + +GET+EDTAK + + D IV+R A E AK Sbjct: 66 AGKRLSADTINISASGSSVVKGETLEDTAKNIEAMNPDAIVMRHNASGACEYLAKRLDCA 125 Query: 120 VIN-GLTDDYHPTQIIADFQTIFEEKGRLKDLKIAYIGD--GNNVAATLLVGASKLGLDI 176 +IN G HP+Q + D TI E KG+++ L +A IGD + V + + +KLG + Sbjct: 126 IINAGDGMHEHPSQALLDAYTIREAKGKIEGLTVAIIGDITHSRVVRSNIYCLTKLGAKV 185 Query: 177 AVATPKGYEIKKEVVDFAKDEAKRSGSNLIFTDNPKEAVKDADVVYTDTWVSMGQEEEKE 236 VA P G + + + K N +A+K +DVV + + +E + Sbjct: 186 RVAGP-GTMLPPGIERLGCEAYK----------NIDDAIKGSDVVMM---LRIQRERQGA 231 Query: 237 KRIKDFEGYQ----VTQELMKLAKEDAIFLHCLPAYRGFEVTPEVIDGPQSKVFDEAENR 292 I Y +T MKLAKEDAI +H P RG E+ + DGPQ+ + D+ EN Sbjct: 232 PLIPSVREYSKFFGLTHARMKLAKEDAIVMHPGPINRGVELPTSIADGPQNVILDQVENG 291 Query: 293 LHAHKAIMVFVCLG 306 + A++ C G Sbjct: 292 VAVRMALLYLACGG 305 Lambda K H 0.319 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 310 Length adjustment: 27 Effective length of query: 281 Effective length of database: 283 Effective search space: 79523 Effective search space used: 79523 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory