Align ABC transporter for L-Arginine, permease component 2 (characterized)
to candidate WP_244151912.1 BUB13_RS17605 amino acid ABC transporter permease
Query= reanno::WCS417:GFF4243 (232 letters) >NCBI__GCF_900142125.1:WP_244151912.1 Length = 319 Score = 127 bits (319), Expect = 3e-34 Identities = 78/219 (35%), Positives = 119/219 (54%), Gaps = 13/219 (5%) Query: 5 YNVIWEAMPLYLGGLLTTLKLLAISLFFGLLAALPLGLMRVSKQPIVNGAAWLYTYVIRG 64 Y W A PL L GL TTL L A + FGL+ L GL RVS + + +Y +IRG Sbjct: 108 YIAEWRAGPL-LVGLWTTLWLSAAASVFGLIIGLVTGLCRVSSNTTLRQLSVIYVELIRG 166 Query: 65 TPMLVQLFLIYYGLAQFEAVRESFLWPLLSSATFCACL-AFAINTSAYTAEIIAGSLKAT 123 TP+LVQ+F+ Y+ FL +L + A + A AI AY AEII +++ Sbjct: 167 TPLLVQIFIFYF-----------FLGTVLDISRIVAGISALAIFAGAYVAEIIRAGIQSI 215 Query: 124 PNGEIEAAKAMGMSRYKLYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGA 183 P G++EAA+++GM+ + I+LP A +R LP + + I +++ +SL S++ + D+T + Sbjct: 216 PKGQMEAARSLGMNVPQAMIHIILPQAFKRTLPPLAGQFISLIKDSSLVSVIAITDLTKS 275 Query: 184 ARTVNAQFYLPFEAYITAGVFYLCLTFILVRLFKLAERR 222 R V + FE + + YL LT L ++ ERR Sbjct: 276 GREVITSTFATFEIWFIVALLYLLLTLSLSQVIAWVERR 314 Lambda K H 0.329 0.140 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 319 Length adjustment: 25 Effective length of query: 207 Effective length of database: 294 Effective search space: 60858 Effective search space used: 60858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory