Align ABC transporter for L-Arginine, putative ATPase component (characterized)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= reanno::BFirm:BPHYT_RS07685 (263 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 149 bits (376), Expect = 9e-41 Identities = 96/280 (34%), Positives = 149/280 (53%), Gaps = 38/280 (13%) Query: 7 TEACKLAVQDIHKRYG--------------DNEVL----------KGVSLNANKGDVISI 42 TE K+ V++++K +G D E + + S KG++ I Sbjct: 2 TEPVKIEVKNLYKIFGPQPKKAMALLKQGLDKEAIFEKTETTVGVQDASFEIFKGEIFVI 61 Query: 43 IGASGSGKSTFLRCINFLERPNAGQIVVDGEMVKTKTDRAGNLEVADHKQLQRIR-TKLA 101 +G SGSGKST +R +N L P +GQ+++DGE + D QL ++R KL+ Sbjct: 62 MGLSGSGKSTMVRMLNRLIEPTSGQVLIDGEDIVAMND----------DQLVKVRRAKLS 111 Query: 102 MVFQHFNLWAHMNVLENIVEAPIHVLGLKRKEAEDRAREYLEKVGLAPRLEKQYPSHLSG 161 MVFQ F L HM VL+N + + G+ ++ E RA + LE+VGL E P LSG Sbjct: 112 MVFQSFALMPHMTVLQNAAFG-LEMDGVDKQTREQRALQALEQVGLEAWAESM-PDELSG 169 Query: 162 GQQQRVAIARALAMNPDVMLFDEPTSALDPELVGEVLKVMQKL-AEEGRTMIVVTHEMGF 220 G QQRV +AR LA++PD++L DE SALDP + E+ + KL A+ RT++ ++H++ Sbjct: 170 GMQQRVGLARGLAVDPDILLMDEAFSALDPLIRTEMQDELLKLQAKAKRTIVFISHDLDE 229 Query: 221 ARNVSNHVMFLHQGRTEEEGLPAEVLSAPRSERLKQFLSG 260 A + + + + GR + G P E+L P + ++ F G Sbjct: 230 AMRIGDRIAIMEGGRVVQVGTPEEILQNPADDYVRAFFRG 269 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 415 Length adjustment: 28 Effective length of query: 235 Effective length of database: 387 Effective search space: 90945 Effective search space used: 90945 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory