Align L-Arginine ABC transporter, ATPase component (characterized)
to candidate WP_072908869.1 BUB13_RS11345 ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5663 (254 letters) >NCBI__GCF_900142125.1:WP_072908869.1 Length = 229 Score = 130 bits (327), Expect = 2e-35 Identities = 83/197 (42%), Positives = 120/197 (60%), Gaps = 15/197 (7%) Query: 14 GSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEELKLVAGK 73 G +L+GV L+ AAG+ +SI+G SG+GK++ L ++ LEQ AG++ +AG Sbjct: 20 GPVNILRGVDLQVAAGETLSIVGPSGAGKTSLLMVLSGLEQADAGRVK--------IAGT 71 Query: 74 DGALKAADPKQLQRMRSR-LSMVFQHFNLWSHMTALENIMEAPVHVLGVTKAQAREKAEH 132 D L+ D L R R R + +VFQ F+L MTALEN+ P+ GV A ++A Sbjct: 72 D--LRQLDEDGLARFRRRQVGIVFQSFHLVPTMTALENVA-LPLEFAGVD--DALQQAHQ 126 Query: 133 YLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPELVGDVLKVM 192 L VG+ R +PG +SGGEQQRVA+ARA +P+++L DEPT LD E V++++ Sbjct: 127 ALTAVGLEQRLQHFPGQLSGGEQQRVALARAFVAKPKLILADEPTGNLDGETGEKVMELL 186 Query: 193 QGLALE-GRTMVVVTHE 208 GL E G T+V+VTH+ Sbjct: 187 FGLQHEFGTTLVLVTHD 203 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 229 Length adjustment: 23 Effective length of query: 231 Effective length of database: 206 Effective search space: 47586 Effective search space used: 47586 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory