Align Ornithine racemase; OR; EC 5.1.1.12 (characterized)
to candidate WP_208610203.1 BUB13_RS17685 alanine/ornithine racemase family PLP-dependent enzyme
Query= SwissProt::C1FW08 (353 letters) >NCBI__GCF_900142125.1:WP_208610203.1 Length = 366 Score = 246 bits (627), Expect = 9e-70 Identities = 131/350 (37%), Positives = 209/350 (59%), Gaps = 6/350 (1%) Query: 3 PKITIDINKLRDNATFIKNLCEKGGCKTALVVKSMCANHDIVKELDSVEVDYFADSRIQN 62 P++ ID+ KL NA+F+ G + K+ + I + + DSR++N Sbjct: 5 PRLNIDLGKLHHNASFLVERLATRGISVTGITKAALGSAKIASAMLRAGISSLGDSRVEN 64 Query: 63 LKKLKD--LKTKKMLLRIPMLCEVEDVVKYADISMNSELDTLKALNKAAKTLNKVHSVII 120 ++ ++ L +L+R PML +V+ VV++ DIS N+E++ ++ L++AAK +VH V++ Sbjct: 65 IEAMRQAQLAATMVLIRSPMLSQVDRVVRHVDISFNTEIEVIRRLSRAAKQAARVHGVVL 124 Query: 121 MVDLGDLREGYFEAEDLKENIKEIIKLENIEIKGIGVNLTCYGAVIPKNDNLSRLCDIAD 180 M++LGDLREG +DL ++E++ L NI KG+G NL C V P N++ L ++ Sbjct: 125 MIELGDLREGIMP-DDLLGTVREMLSLPNICFKGLGTNLACRSGVCPDEKNMALLSELVA 183 Query: 181 ELRTEFNLELPIVSGGNSSSIYLIDKGELPEGITNLRVGESMLLGRETAYGEDIIGMNND 240 + + F L++ IVSGGNS+++ G I +LR+GE++LLGRET Y + I G++ D Sbjct: 184 AIESTFGLKVEIVSGGNSANLQWALSGAKTGRINDLRLGEAILLGRETLYRQPIDGLHTD 243 Query: 241 VFELKCQIVELKEKPSLPIGEIGVDAFGNKPYYEDKGIRKRAILAIGQQDTDISSLMPID 300 L +++E K KPS P G+I AFG P D+G ++ ILAIGQQDTD L+P Sbjct: 244 AITLTAEVIEAKTKPSKPTGQIAQAAFGEAPAAIDRGEVRQNILAIGQQDTDPCGLLP-P 302 Query: 301 DKLEILGASSDHLIVDVSDSNTSYKVGDIITFRMGYGALLKGFTSEYIEK 350 +++GASSDHLI++ D VG +TF++ Y AL++ TS ++ K Sbjct: 303 AGTQVMGASSDHLILETDDE--KLPVGKEVTFQLNYSALVRSMTSPFVAK 350 Lambda K H 0.317 0.138 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 366 Length adjustment: 29 Effective length of query: 324 Effective length of database: 337 Effective search space: 109188 Effective search space used: 109188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory