Align ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized)
to candidate WP_072904804.1 BUB13_RS00570 cell division ATP-binding protein FtsE
Query= reanno::pseudo1_N1B4:Pf1N1B4_774 (244 letters) >NCBI__GCF_900142125.1:WP_072904804.1 Length = 224 Score = 151 bits (381), Expect = 1e-41 Identities = 77/219 (35%), Positives = 137/219 (62%), Gaps = 3/219 (1%) Query: 1 MISIKNVNKWYG-DFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVI 59 MI + NV K YG + + D S ++ KG+ + V G SG+GK+T ++ + A E +G ++ Sbjct: 1 MIQLFNVTKSYGGESPAVKDLSIQIPKGDFVYVTGASGAGKTTFLRMLYAAEKPTRGQIL 60 Query: 60 VDGTSIADPKTN-LPKLRSRVGMVFQHFELFPHLSIMDNLTIAQVKVLGRSKEEASKKAL 118 ++ +I ++ +P LR ++G+VFQ F+L ++ +N+ A ++ G+ + E SKK Sbjct: 61 INNQNITRIRSGQIPYLRRKIGVVFQDFKLLQSRTVYENVAFA-LEAQGKKRYEVSKKVY 119 Query: 119 QLLERVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDV 178 Q L+ VGL ++ P +LSGG+QQR+AIARAL +DP+++L DEP+ LD E+ +++++ Sbjct: 120 QALKEVGLEHRLQRKPLELSGGEQQRIAIARALVVDPLILLADEPSGNLDQEVTLDIMEL 179 Query: 179 MVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIED 217 + G T++ TH+ R+ RV+ +D+G++I D Sbjct: 180 FKKANARGTTVLLATHDHSLHRRFPRRVMTLDKGRLIAD 218 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 224 Length adjustment: 23 Effective length of query: 221 Effective length of database: 201 Effective search space: 44421 Effective search space used: 44421 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory