Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate WP_244151869.1 BUB13_RS11695 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >NCBI__GCF_900142125.1:WP_244151869.1 Length = 240 Score = 292 bits (747), Expect = 5e-84 Identities = 146/242 (60%), Positives = 185/242 (76%), Gaps = 2/242 (0%) Query: 1 MISIKSINKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 60 MI I ++KWYGDF VL+D + EV++GE IV+CGPSGSGKST+I+C+N LE Q+G I+V Sbjct: 1 MIKIVGMHKWYGDFHVLSDINLEVQEGERIVICGPSGSGKSTMIRCINRLEEHQQGQIIV 60 Query: 61 DGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKKGLQL 120 +GT + + N+ +R+ VGMVFQHF LFPHLTI ENLT+ QI V K++A + + Sbjct: 61 NGTELTNDIKNIETVRAEVGMVFQHFNLFPHLTILENLTLGQIWVRKTPKKQAEETAMMY 120 Query: 121 LERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVMV 180 LE+V ++ A K PGQLSGGQQQRVAIAR+L M P VMLFDEPTSALDPEM+ EVLDVM+ Sbjct: 121 LEKVKIAEQAKKFPGQLSGGQQQRVAIARSLCMAPEVMLFDEPTSALDPEMIKEVLDVMI 180 Query: 181 QLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARAERTQHFLNK 240 LA EGMTM+ VTHEMGFA+ VADRV+FMD G+I+E +FF N + ERT+ FL++ Sbjct: 181 DLAEEGMTMLVVTHEMGFAKSVADRVMFMDAGQIVEQNNPHDFFD--NPQHERTKLFLSQ 238 Query: 241 IL 242 IL Sbjct: 239 IL 240 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 240 Length adjustment: 23 Effective length of query: 221 Effective length of database: 217 Effective search space: 47957 Effective search space used: 47957 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory