Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate WP_279626006.1 BUB13_RS17610 amino acid ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >NCBI__GCF_900142125.1:WP_279626006.1 Length = 235 Score = 277 bits (709), Expect = 1e-79 Identities = 137/220 (62%), Positives = 174/220 (79%) Query: 21 STEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVG 80 +T +K GEVVVV GPSGSGKST ++ +NGLE + G I +DGI + DKKTDL K+R VG Sbjct: 16 TTHIKSGEVVVVIGPSGSGKSTYLRCLNGLETLTDGHIMIDGIDLADKKTDLNKVRREVG 75 Query: 81 MVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGG 140 MVFQ F LFPH ++++N+ LAQ V KR++ A +KA +LL++VG++ + +P LSGG Sbjct: 76 MVFQQFNLFPHKTVLDNIILAQQVVRKRNRKEAEDKARQLLKKVGIADKESVYPGHLSGG 135 Query: 141 QQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFAR 200 QQQRVAIARAL MDP MLFDEPTSALDPEM+ EVLDVM +LA EGMTM+VVTHEMGFAR Sbjct: 136 QQQRVAIARALAMDPKIMLFDEPTSALDPEMVGEVLDVMKQLAREGMTMVVVTHEMGFAR 195 Query: 201 KVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLAKIL 240 +VA+RVIFMD GK+VE+ + FF +P+ +RAKDFL ++L Sbjct: 196 EVADRVIFMDHGKLVEEGTPEHFFTEPREERAKDFLRQVL 235 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 235 Length adjustment: 23 Effective length of query: 218 Effective length of database: 212 Effective search space: 46216 Effective search space used: 46216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory