Align ATPase (characterized, see rationale)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 137 bits (344), Expect = 5e-37 Identities = 82/218 (37%), Positives = 122/218 (55%), Gaps = 4/218 (1%) Query: 42 SLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRL--SHDRRDIATIRQE 99 S + +GE+ V+MG SGSGKST +R LN L G++ I+G + +D + + R + Sbjct: 50 SFEIFKGEIFVIMGLSGSGKSTMVRMLNRLIEPTSGQVLIDGEDIVAMNDDQLVKVRRAK 109 Query: 100 VGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYPGQLS 159 + MVFQ F L PH+TVLQN +++ E A Q LE+V + A+ P +LS Sbjct: 110 LSMVFQSFALMPHMTVLQNAAFG-LEMDGVDKQTREQRALQALEQVGLEAWAESMPDELS 168 Query: 160 GGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDL-ASEGMTMLVATHEVG 218 GG QQRV +AR LA+ P ILL DE SALDP + E+ D + L A T++ +H++ Sbjct: 169 GGMQQRVGLARGLAVDPDILLMDEAFSALDPLIRTEMQDELLKLQAKAKRTIVFISHDLD 228 Query: 219 FAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQF 256 A + DR+ +M G++V+ P+ P D + F Sbjct: 229 EAMRIGDRIAIMEGGRVVQVGTPEEILQNPADDYVRAF 266 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 415 Length adjustment: 28 Effective length of query: 233 Effective length of database: 387 Effective search space: 90171 Effective search space used: 90171 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory