Align BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_208610168.1 BUB13_RS12685 amino acid ABC transporter permease
Query= TCDB::Q52665 (434 letters) >NCBI__GCF_900142125.1:WP_208610168.1 Length = 249 Score = 101 bits (252), Expect = 2e-26 Identities = 66/202 (32%), Positives = 110/202 (54%), Gaps = 10/202 (4%) Query: 226 GFLLALVIGVTAIVVSLPLGILLALGRQSDMLIVKSLSVGIIEFVRGVPLITLLFTASLL 285 G L L I V ++++SL +G+L AL R S + K ++ +E +R PL+ +F + Sbjct: 51 GLWLTLEITVVSLLLSLVIGLLTALMRLSRSPMAKGIAWVYLEAIRNTPLLIQIF----I 106 Query: 286 LQYFLPPGTNFDLILRVVILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWQAQR 345 + + P + V+ ++LF AY +E+IR G+ A+P GQ+EA+ +LGL Q R Sbjct: 107 IYFVFAPILDLGRFSSAVLALSLFEGAYASEIIRAGILAIPLGQWEASASLGLKPPQIYR 166 Query: 346 LIIMPQALKISIPGIVSSFIGLFKDTTLVAFVGLFD-PLKGISNVVRSDMAWKGTYWEPY 404 II+PQA++ IP + S I L KD+ LV+ + ++D ++G V + + +E + Sbjct: 167 FIILPQAIRQMIPPLTSQGISLIKDSALVSTIAIYDLTMQGQQIVAETFLT-----FEIW 221 Query: 405 IFVALIFFLFNFSMSRYSMYLE 426 VA I+ L +S YLE Sbjct: 222 FTVAAIYLLVTTLLSLLVRYLE 243 Lambda K H 0.329 0.143 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 249 Length adjustment: 28 Effective length of query: 406 Effective length of database: 221 Effective search space: 89726 Effective search space used: 89726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory