Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_072905109.1 BUB13_RS02235 ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_900142125.1:WP_072905109.1 Length = 230 Score = 133 bits (335), Expect = 3e-36 Identities = 80/226 (35%), Positives = 123/226 (54%), Gaps = 9/226 (3%) Query: 1 MIELKNVNKYYGTH----HVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSG 56 +IE+ N+ K + T HVL+ ++ + GE++ ++G SG+GK+T + + GL+ S G Sbjct: 6 LIEICNLQKRFSTPGGEIHVLRQVDAQISAGERVAVVGTSGAGKTTLMHILGGLDRPSDG 65 Query: 57 EVVVNN---LVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAE 113 EV + L E + VFQ L P T L+N+ + P+ + + EA Sbjct: 66 EVRFSGEDIFALRGVALDEFRNRTVGFVFQFHQLLPEFTALENVMM-PLLIGGVGRTEAA 124 Query: 114 ETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQE 173 E A + L VGL + N P LSGG+QQRVAIAR+L + +L DEPT LD T E Sbjct: 125 EKATELLGEVGLEQRLNHKPGALSGGEQQRVAIARALVRQPQILLADEPTGNLDSGTSDE 184 Query: 174 VLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENI 219 +L ++ + TM++VTH A + DRI+ MEDG +V++ + Sbjct: 185 ILQLLNRMHRTRGLTMLIVTHNRELAASL-DRILRMEDGRLVDDQL 229 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 230 Length adjustment: 23 Effective length of query: 219 Effective length of database: 207 Effective search space: 45333 Effective search space used: 45333 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory