Align ATPase (characterized, see rationale)
to candidate WP_072909430.1 BUB13_RS14165 ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_900142125.1:WP_072909430.1 Length = 234 Score = 135 bits (341), Expect = 6e-37 Identities = 77/203 (37%), Positives = 121/203 (59%), Gaps = 6/203 (2%) Query: 20 TMIYAEGVEKWYGN---QFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQR 76 ++I A+ + K Y + +A+ GV +++ V +GPSGSGKST L + L+ Sbjct: 2 SVIVAKQLTKTYVTGDIKVEAIRGVDFSIEPASFVSFIGPSGSGKSTLLNMIGCLDPPTA 61 Query: 77 GEIWIEGHRLSH-DRRDIATIRQE-VGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQA 134 G + + G +++ +R+D A R E +G VFQ FNL P LTV +N+ V+ WP + Sbjct: 62 GLLEVVGQEITNLNRQDAARFRGEHIGFVFQDFNLIPVLTVFENVEYPLQMVQSWPKEKR 121 Query: 135 EATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVR 194 +++LE V + +Q +KYP Q+SGGQ+QRVA+ARAL +++L DEPT+ LD E Sbjct: 122 RERVQEMLEAVGMGDQGNKYPSQISGGQKQRVAVARALVTNAKLVLADEPTANLDRETAT 181 Query: 195 EVLDVMRDLASEGMTMLV-ATHE 216 V+D+M+ + E T V +TH+ Sbjct: 182 MVIDLMKKMRDEYQTTFVFSTHD 204 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 234 Length adjustment: 24 Effective length of query: 237 Effective length of database: 210 Effective search space: 49770 Effective search space used: 49770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory