Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 151 bits (382), Expect = 2e-41 Identities = 81/222 (36%), Positives = 136/222 (61%), Gaps = 4/222 (1%) Query: 38 LRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVDGIELTS--DLKNIDK 95 ++D + + +GE VI G SGSGKSTM+R +NRL E SG++++DG ++ + D + + Sbjct: 46 VQDASFEIFKGEIFVIMGLSGSGKSTMVRMLNRLIEPTSGQVLIDGEDIVAMNDDQLVKV 105 Query: 96 VRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYLEKVKIPEQAQKYP 155 R+++ MVFQ F L PH+T+L+N + + V K+ E+ A+ LE+V + A+ P Sbjct: 106 RRAKLSMVFQSFALMPHMTVLQNAAFG-LEMDGVDKQTREQRALQALEQVGLEAWAESMP 164 Query: 156 GQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQL-AEEGMTMLCVT 214 +LSGG QQRV +AR L + P I+L DE SALDP + E+ D +++L A+ T++ ++ Sbjct: 165 DELSGGMQQRVGLARGLAVDPDILLMDEAFSALDPLIRTEMQDELLKLQAKAKRTIVFIS 224 Query: 215 HEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQF 256 H++ A + +R+ M G++V+ P + NP + + F Sbjct: 225 HDLDEAMRIGDRIAIMEGGRVVQVGTPEEILQNPADDYVRAF 266 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 415 Length adjustment: 28 Effective length of query: 235 Effective length of database: 387 Effective search space: 90945 Effective search space used: 90945 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory