Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 129 bits (325), Expect = 8e-35 Identities = 93/268 (34%), Positives = 146/268 (54%), Gaps = 22/268 (8%) Query: 11 YPVDEPVAQPVTAAIK--LQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTM 68 Y + P + A +K L E I ++ ++ S +G++ ++G SGSGKSTM Sbjct: 13 YKIFGPQPKKAMALLKQGLDKEAIFEKTETTVGVQDASFEIFKGEIFVIMGLSGSGKSTM 72 Query: 69 LRCINFLEQPDAGVITLDGISIEMRQGRAGTRAPHQDQLQNLR-TRLAMVFQHFNLWSHM 127 +R +N L +P +G + +DG I A + DQL +R +L+MVFQ F L HM Sbjct: 73 VRMLNRLIEPTSGQVLIDGEDIV---------AMNDDQLVKVRRAKLSMVFQSFALMPHM 123 Query: 128 TVLENITMAPRRVLDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARAL 187 TVL+N + V E+RA L++VGL + A+ P LSGG QQRV +AR L Sbjct: 124 TVLQNAAFG-LEMDGVDKQTREQRALQALEQVGLEAW-AESMPDELSGGMQQRVGLARGL 181 Query: 188 AMEPEIILFDEPTSALDP----ELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVL 243 A++P+I+L DE SALDP E+ E+LK+ A+ RT++ ++H++ A ++ ++ Sbjct: 182 AVDPDILLMDEAFSALDPLIRTEMQDELLKL---QAKAKRTIVFISHDLDEAMRIGDRIA 238 Query: 244 FLHQGRVEEHG-DARILDQPNSERLQQF 270 + GRV + G IL P + ++ F Sbjct: 239 IMEGGRVVQVGTPEEILQNPADDYVRAF 266 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 415 Length adjustment: 28 Effective length of query: 248 Effective length of database: 387 Effective search space: 95976 Effective search space used: 95976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory