Align Carbamate kinase; EC 2.7.2.2; Carbamate kinase-like carbamoylphosphate synthase (uncharacterized)
to candidate WP_072909653.1 BUB13_RS15350 carbamate kinase
Query= curated2:O59023 (314 letters) >NCBI__GCF_900142125.1:WP_072909653.1 Length = 315 Score = 274 bits (701), Expect = 2e-78 Identities = 148/314 (47%), Positives = 208/314 (66%), Gaps = 11/314 (3%) Query: 1 MPERVVIALGGNALQQRGQKGTYDEMMENVRKTAKQIAEIIARGYEVVITHGNGPQVGTI 60 M E +VIALGGNAL ++GQ GT +E N++ +QIA + + + ++ITHGNGPQVG + Sbjct: 6 MRETLVIALGGNALIRKGQAGTIEEQFANLKGPMQQIARL-SMDFRIIITHGNGPQVGNL 64 Query: 61 LLHMDAGQSLHGIPAQPMDVAGAMSQGWIGYMIQQALRNELRK-RGIE-KEVVTIITQTI 118 LL + S +P P+++ A +QG +GYMI+ L E K +G + K++V++I+ + Sbjct: 65 LLQQE---SCCDVPKLPLEILVAQTQGQLGYMIESTLDTEFMKIKGAQSKQLVSLISYVV 121 Query: 119 VDKKDPAFQNPTKPVGPFYDEKTAKKLAKEKGWVVKEDAGRGWRRVVPSPDPKGHVEAET 178 VD+ DPAFQ P+KPVGP Y E L W V + A G+RRVV SP P VE + Sbjct: 122 VDEADPAFQKPSKPVGPSYPEGAVDSLP----WPVVKTAN-GYRRVVASPAPVTIVEKQE 176 Query: 179 IRRLVESGIIVIASGGGGVPVIEENGEIKGVEAVIDKDLAGEKLAEEVNADILMILTDVN 238 IR+LV IVI GGGG+PVI E GV+AVIDKDLA +LA EV AD+L+I TDV Sbjct: 177 IRKLVAMDFIVICCGGGGIPVIREERGFHGVDAVIDKDLASARLASEVEADVLVIATDVE 236 Query: 239 GAALYYGTEKETWLRNVKVEELEKYYQEGHFKAGSMGPKVLAAIRFIKNGGKRAIIAHLE 298 GAAL +G ++ +LR++ + E++ ++GHF AGSMGPKV AA++F++ GGKR+II L+ Sbjct: 237 GAALSFGQPEQKFLRHISCVQAEQWLRQGHFPAGSMGPKVKAAVQFVREGGKRSIITSLD 296 Query: 299 KAVEALEGKTGTQV 312 EA+ G GT++ Sbjct: 297 AICEAVSGTAGTEI 310 Lambda K H 0.314 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 315 Length adjustment: 27 Effective length of query: 287 Effective length of database: 288 Effective search space: 82656 Effective search space used: 82656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory