Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate WP_244151912.1 BUB13_RS17605 amino acid ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_00470 (220 letters) >NCBI__GCF_900142125.1:WP_244151912.1 Length = 319 Score = 132 bits (332), Expect = 7e-36 Identities = 69/202 (34%), Positives = 117/202 (57%), Gaps = 1/202 (0%) Query: 18 LWAGFLTSVQCSLLAIVLGTLIGLVAGLVLTYGRTWMRAPFRFYVDLIRGTPVFVLVLAC 77 L G T++ S A V G +IGLV GL T +R YV+LIRGTP+ V + Sbjct: 117 LLVGLWTTLWLSAAASVFGLIIGLVTGLCRVSSNTTLRQLSVIYVELIRGTPLLVQIFI- 175 Query: 78 FYMAPALGWQIGAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASQAIGLTFYQSLG 137 FY I AG+ L +F G++VAEI+R +Q++P+GQMEA++++G+ Q++ Sbjct: 176 FYFFLGTVLDISRIVAGISALAIFAGAYVAEIIRAGIQSIPKGQMEAARSLGMNVPQAMI 235 Query: 138 YVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTLEFYLFAGF 197 +++LPQA ++ LP ++K S+L+SVI + +L S +++I TF T E + Sbjct: 236 HIILPQAFKRTLPPLAGQFISLIKDSSLVSVIAITDLTKSGREVITSTFATFEIWFIVAL 295 Query: 198 LFFIINYAIELLGRHIEKRVAL 219 L+ ++ ++ + +E+R+A+ Sbjct: 296 LYLLLTLSLSQVIAWVERRLAV 317 Lambda K H 0.330 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 319 Length adjustment: 25 Effective length of query: 195 Effective length of database: 294 Effective search space: 57330 Effective search space used: 57330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory