Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate WP_208610168.1 BUB13_RS12685 amino acid ABC transporter permease
Query= TCDB::P48245 (273 letters) >NCBI__GCF_900142125.1:WP_208610168.1 Length = 249 Score = 105 bits (261), Expect = 1e-27 Identities = 68/201 (33%), Positives = 108/201 (53%), Gaps = 6/201 (2%) Query: 26 ILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIFA 85 +L GLW TL+ V S++L+LV+G L R+S + + V +E R P+LI + Sbjct: 48 LLQGLWLTLEITVVSLLLSLVIGLLTALMRLSRSPMAKGIAWVYLEAIRNTPLLIQIFII 107 Query: 86 YQMFAQYNIVPSSQLA-FAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAAIALGMSSR 144 Y +FA P L F++ V L+++ G+ +EI+R+GI ++P GQ EA+ +LG+ Sbjct: 108 YFVFA-----PILDLGRFSSAVLALSLFEGAYASEIIRAGILAIPLGQWEASASLGLKPP 162 Query: 145 QTTWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNRNYLAALF 204 Q I+LPQA+ M+P L SQ + +KDSAL I ++ G Q + F Sbjct: 163 QIYRFIILPQAIRQMIPPLTSQGISLIKDSALVSTIAIYDLTMQGQQIVAETFLTFEIWF 222 Query: 205 VVALIMIVLNFSLTALASRIE 225 VA I +++ L+ L +E Sbjct: 223 TVAAIYLLVTTLLSLLVRYLE 243 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 249 Length adjustment: 25 Effective length of query: 248 Effective length of database: 224 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory