Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_208610168.1 BUB13_RS12685 amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_900142125.1:WP_208610168.1 Length = 249 Score = 150 bits (379), Expect = 2e-41 Identities = 81/204 (39%), Positives = 131/204 (64%), Gaps = 3/204 (1%) Query: 9 WAGVPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPL 68 W P LL G +T+EIT SLLL V+GLL + RL+ + + + Y+ AIR TPL Sbjct: 43 WQAGP-LLQGLWLTLEITVVSLLLSLVIGLLTALMRLS-RSPMAKGIAWVYLEAIRNTPL 100 Query: 69 LVQLFILFFGLPQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIGM 128 L+Q+FI++F + L F V+ L ++ GAY SE++R I +I GQ EA+ S+G+ Sbjct: 101 LIQIFIIYFVFAPI-LDLGRFSSAVLALSLFEGAYASEIIRAGILAIPLGQWEASASLGL 159 Query: 129 SSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSLE 188 R ++LPQA+ +MIPPL ++ I+LIK+SALVS + I+DL +GQ+I++ ++ + E Sbjct: 160 KPPQIYRFIILPQAIRQMIPPLTSQGISLIKDSALVSTIAIYDLTMQGQQIVAETFLTFE 219 Query: 189 VYLAIAVVYFILTGATTLVLRRIE 212 ++ +A +Y ++T +L++R +E Sbjct: 220 IWFTVAAIYLLVTTLLSLLVRYLE 243 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 249 Length adjustment: 23 Effective length of query: 199 Effective length of database: 226 Effective search space: 44974 Effective search space used: 44974 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory