Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_244151912.1 BUB13_RS17605 amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_900142125.1:WP_244151912.1 Length = 319 Score = 160 bits (405), Expect = 3e-44 Identities = 87/207 (42%), Positives = 137/207 (66%), Gaps = 3/207 (1%) Query: 9 WAGVPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPL 68 W P LL G T+ ++AA+ + G ++GL+ G+ R++ + L YV IRGTPL Sbjct: 112 WRAGP-LLVGLWTTLWLSAAASVFGLIIGLVTGLCRVS-SNTTLRQLSVIYVELIRGTPL 169 Query: 69 LVQLFILFFGLPQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIGM 128 LVQ+FI +F L + + V G+ L I++GAYV+E++R IQSI KGQMEAARS+GM Sbjct: 170 LVQIFIFYFFLGTV-LDISRIVAGISALAIFAGAYVAEIIRAGIQSIPKGQMEAARSLGM 228 Query: 129 SSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSLE 188 + AM ++LPQA R +PPL +FI+LIK+S+LVS++ I DL G+++I+ ++ + E Sbjct: 229 NVPQAMIHIILPQAFKRTLPPLAGQFISLIKDSSLVSVIAITDLTKSGREVITSTFATFE 288 Query: 189 VYLAIAVVYFILTGATTLVLRRIELRL 215 ++ +A++Y +LT + + V+ +E RL Sbjct: 289 IWFIVALLYLLLTLSLSQVIAWVERRL 315 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 319 Length adjustment: 25 Effective length of query: 197 Effective length of database: 294 Effective search space: 57918 Effective search space used: 57918 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory