Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate WP_244151912.1 BUB13_RS17605 amino acid ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >NCBI__GCF_900142125.1:WP_244151912.1 Length = 319 Score = 109 bits (272), Expect = 8e-29 Identities = 61/210 (29%), Positives = 116/210 (55%), Gaps = 10/210 (4%) Query: 15 LLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYILVFRGSPLLIQMFLV 74 LL + TTL L + + G ++ LV RVS + + + Y+ + RG+PLL+Q+F+ Sbjct: 117 LLVGLWTTLWLSAAASVFGLIIGLVTGLCRVSSNTTLRQLSVIYVELIRGTPLLVQIFIF 176 Query: 75 YYGMGQFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGLMAVPVGQIEAGYSI 134 Y+ +G I + + +LA+ Y AEIIR G+ ++P GQ+EA S+ Sbjct: 177 YFFLGTVLDISR----------IVAGISALAIFAGAYVAEIIRAGIQSIPKGQMEAARSL 226 Query: 135 GLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVTGVAQQIIQQTYRT 194 G++ + +I P A ++ LP + + + L+K ++L S++ + ++T +++I T+ T Sbjct: 227 GMNVPQAMIHIILPQAFKRTLPPLAGQFISLIKDSSLVSVIAITDLTKSGREVITSTFAT 286 Query: 195 TEVFICAALIYLFLNFVIVRLLGMLETRLS 224 E++ AL+YL L + +++ +E RL+ Sbjct: 287 FEIWFIVALLYLLLTLSLSQVIAWVERRLA 316 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 319 Length adjustment: 26 Effective length of query: 224 Effective length of database: 293 Effective search space: 65632 Effective search space used: 65632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory